PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010549657.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family G2-like
Protein Properties Length: 461aa    MW: 51365.9 Da    PI: 5.5061
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010549657.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.38.5e-34250304155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     k+r+rWtpeLHe+Fveav+qLGGse+AtPk++l+lm+ +gLt++hvkSHLQkYR+
  XP_010549657.1 250 KQRMRWTPELHESFVEAVNQLGGSERATPKAVLKLMNNPGLTIYHVKSHLQKYRT 304
                     79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.96E-18249304IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.4E-31250306IPR009057Homeodomain-like
TIGRFAMsTIGR015575.3E-24250304IPR006447Myb domain, plants
PfamPF002495.7E-11252303IPR001005SANT/Myb domain
PfamPF143791.7E-23341386IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 461 aa     Download sequence    Send to blast
MTLASNFGFS AAMSSFFPAL PTTLEERYNK LPYSFWVPSV QEPMNNPVPC QASPLVSGGD  60
SGGRLFSPSS GFCSGMHVSS VSSHERNSQT QPSVSTMPRE RALSRVAGEG QIQDCPLEIQ  120
SQSLISHSQE QKDMPWCADP MQGFFDFPDH VPIQNPPAES SRGMVSSEDL HKKSEWQEWA  180
DHLISVDDGL EPNWSELLGD PSLQNHDSKI SPQSSDIPRE EVKIKQHQTV VSSGEQFSGK  240
NSSSSAPPLK QRMRWTPELH ESFVEAVNQL GGSERATPKA VLKLMNNPGL TIYHVKSHLQ  300
KYRTARYKPE SSEGTEGEPS EKKLTSIEDI KSLDLKTSIG ITEALRLQME VQKRLHEQLE  360
IQRKLQLQIE EQGRYLQKMF EKQQKMQDNQ NKGPNPDDDD DDPSAPLQDQ SSPSPKKSDS  420
SGSQPRQDNV ASRKEKKGDG FSSADEDRSS SSPSKKRARE D
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00532DAPTransfer from AT5G29000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010549657.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X1
SwissprotQ8GUN50.0PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLD7M7061e-177D7M706_ARALL; Myb family transcription factor
STRINGAT5G29000.21e-178(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85627117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G29000.21e-165G2-like family protein