PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010549620.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 342aa    MW: 38556.2 Da    PI: 8.5712
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010549620.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.62.5e-5391331128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeel+ +yL+kkv+++++++ ++i++vdiyk++PwdLp+k+  +ekewyfFs+rd+ky++g r+nra++sgyWkatg+d+ +   
  XP_010549620.1   9 LPPGFRFHPTDEELILHYLRKKVSSSPVPV-SIIADVDIYKFDPWDLPAKAPFGEKEWYFFSPRDRKYPNGGRPNRAAASGYWKATGTDRMIGG- 101
                     79****************************.89***************988899*************************************977. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +e++g+kk Lvfykgr pkg+kt+W+mheyrl
  XP_010549620.1 102 -DENIGVKKALVFYKGRPPKGVKTNWIMHEYRL 133
                     .889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.18E-626174IPR003441NAC domain
PROSITE profilePS5100560.9899174IPR003441NAC domain
PfamPF023653.3E-2810133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MSRDPRSNLP PGFRFHPTDE ELILHYLRKK VSSSPVPVSI IADVDIYKFD PWDLPAKAPF  60
GEKEWYFFSP RDRKYPNGGR PNRAAASGYW KATGTDRMIG GDENIGVKKA LVFYKGRPPK  120
GVKTNWIMHE YRLSQTLSSK QRNRVSNGGD QALKPPQPSS MRLDDWVLCR IYKKSQASSS  180
SPAVNAATSD QEREDDEEET LFPRLPQLTT LSSVAVNDNT LKPQRSCSFS NLLETGDLSF  240
LASFLAENSE NQAEFEFQFP LVFGSSDLDQ GNGCLGQKLP QMTSPPLEKF GVDNKRQRSG  300
LIEDTMNPSK KTCSYNNNTE HFDNGFTKQQ LLLSSRHLQF QG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-69817816169NO APICAL MERISTEM PROTEIN
1ut4_B8e-69817816169NO APICAL MERISTEM PROTEIN
1ut7_A8e-69817816169NO APICAL MERISTEM PROTEIN
1ut7_B8e-69817816169NO APICAL MERISTEM PROTEIN
3swm_A8e-69817819172NAC domain-containing protein 19
3swm_B8e-69817819172NAC domain-containing protein 19
3swm_C8e-69817819172NAC domain-containing protein 19
3swm_D8e-69817819172NAC domain-containing protein 19
3swp_A8e-69817819172NAC domain-containing protein 19
3swp_B8e-69817819172NAC domain-containing protein 19
3swp_C8e-69817819172NAC domain-containing protein 19
3swp_D8e-69817819172NAC domain-containing protein 19
4dul_A8e-69817816169NAC domain-containing protein 19
4dul_B8e-69817816169NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the promoter of ACO5, an ACC oxidase involved in ethylene biosynthesis. Mediates waterlogging-induced hyponastic leaf movement, and cell expansion in abaxial cells of the basal petiole region, by directly regulating the expression of ACO5 (PubMed:24363315). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000269|PubMed:24363315}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010549620.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By root flooding (PubMed:24363315). Induced by senescence (PubMed:24659488). {ECO:0000269|PubMed:24363315, ECO:0000269|PubMed:24659488}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010549620.10.0PREDICTED: NAC transcription factor 29
SwissprotQ84TD61e-143NAC47_ARATH; NAC transcription factor 47
TrEMBLV4M0Q71e-144V4M0Q7_EUTSA; Uncharacterized protein
STRINGXP_010549620.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM77232540
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04070.11e-139NAC domain containing protein 47
Publications ? help Back to Top
  1. Hofmann NR
    A NAC transcription factor for flooding: SHYG helps plants keep their leaves in the air.
    Plant Cell, 2013. 25(12): p. 4771
    [PMID:24363314]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]