PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010549375.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family VOZ
Protein Properties Length: 472aa    MW: 52344.6 Da    PI: 5.8286
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010549375.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ433.92.2e-1331924091217
             VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaael 95 
                     pppsaflgpkcalwdc+rpa g++w++dycs+fha+la+neg+pg++pv+rp+gi+lkdgllf+alsak++gk+vgipecegaatakspwna+el
  XP_010549375.1 192 PPPSAFLGPKCALWDCPRPALGFDWFHDYCSNFHAALAFNEGPPGMNPVVRPGGIGLKDGLLFSALSAKAEGKDVGIPECEGAATAKSPWNAPEL 286
                     89********************************************************************************************* PP

             VOZ  96 fdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklv 190
                     fdl++legetirewlffdkprrafesgnrkqrslpdysgrgwhesrkq+m+efgglkrsyymdpqp+++fewhlyeyein+++a+alyrlelklv
  XP_010549375.1 287 FDLTVLEGETIREWLFFDKPRRAFESGNRKQRSLPDYSGRGWHESRKQIMNEFGGLKRSYYMDPQPLHHFEWHLYEYEINKCEACALYRLELKLV 381
                     *********************************************************************************************** PP

             VOZ 191 dekksakgkvskdsl.adlqkklgrlta 217
                     d+kk++kgkvs+ds+ adlq+++g+lta
  XP_010549375.1 382 DGKKNSKGKVSSDSVvADLQRQMGKLTA 409
                     ************99538*********97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 472 aa     Download sequence    Send to blast
MTGKRTKTSC RSAPHKLFKD KAKNRVDDLQ GMLLDLQLAR KESRSSNVTL LEEQIHQMLR  60
EWKAELNEPS PASSLQQGGT LGSFSSDICR LLQLYDDEDD ATSKLAAPKP EPLDPGLEVG  120
NTNVFQGGKS EHGFPLVDHG NDYDGTAQLE YHQYDLMQQG FEQNFNGGFN DCLGLGGEDA  180
LNISALMPTF CPPPSAFLGP KCALWDCPRP ALGFDWFHDY CSNFHAALAF NEGPPGMNPV  240
VRPGGIGLKD GLLFSALSAK AEGKDVGIPE CEGAATAKSP WNAPELFDLT VLEGETIREW  300
LFFDKPRRAF ESGNRKQRSL PDYSGRGWHE SRKQIMNEFG GLKRSYYMDP QPLHHFEWHL  360
YEYEINKCEA CALYRLELKL VDGKKNSKGK VSSDSVVADL QRQMGKLTAE FPSDNNKRCI  420
KIRPKGNGKS PDGNGYSARN TTNPTDDSKF GSGAGAEYNS YLVGNLGDYY IN
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010549375.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010549375.10.0PREDICTED: transcription factor VOZ1-like isoform X2
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A1J3GRC40.0A0A1J3GRC4_NOCCA; Transcription factor VOZ1
STRINGXP_010549368.10.0(Tarenaya hassleriana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]