PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010549337.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family SBP
Protein Properties Length: 166aa    MW: 19137.1 Da    PI: 8.3751
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010549337.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.33.8e-4278155178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +Cqve+C++d++ ak+yh+rhkvC++h+kapvv vsgl+qrfCqqCsrfhe+ efDe+krsCrrrLa+hnerrrk ++
  XP_010549337.1  78 VCQVENCNVDMTGAKRYHKRHKVCDFHAKAPVVNVSGLHQRFCQQCSRFHEIGEFDEAKRSCRRRLAGHNERRRKVSN 155
                     6**************************************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0375752.2E-5619166IPR017238Squamosa promoter-binding protein
Gene3DG3DSA:4.10.1100.101.4E-3272140IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.61676153IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.01E-3878157IPR004333Transcription factor, SBP-box
PfamPF031103.5E-3279152IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010229Biological Processinflorescence development
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MNRKSSALPP MMSMGTTKAE GKRSLREMGE KEREREREEE EEEEEDDDQN EAEAEKKKKG  60
KKAAYGSSSS SSRESYNVCQ VENCNVDMTG AKRYHKRHKV CDFHAKAPVV NVSGLHQRFC  120
QQCSRFHEIG EFDEAKRSCR RRLAGHNERR RKVSNEYQSG EGSNQT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A8e-3766152184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00290DAPTransfer from AT2G33810Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010549337.11e-119PREDICTED: squamosa promoter-binding-like protein 3
SwissprotP930155e-50SPL3_ARATH; Squamosa promoter-binding-like protein 3
TrEMBLS4WY881e-56S4WY88_ARAAL; Squamosa promoter-binding-like protein
STRINGfgenesh2_kg.4__1394__AT2G33810.16e-49(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.13e-44squamosa promoter binding protein-like 3