PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010549128.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 317aa    MW: 35981.4 Da    PI: 7.2517
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010549128.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.93.3e-5651311129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeel+++yL++kv++  +++ ++i evd++k+ePwdLp++++ +ekewyfFs rd+ky+tg r+nrat++gyWk+tgkdke+++ 
  XP_010549128.1   5 LPPGFRFHPTDEELITHYLCRKVSEVGFTA-KAIVEVDLNKCEPWDLPAMASMGEKEWYFFSLRDRKYPTGLRTNRATEAGYWKTTGKDKEIYR- 97 
                     79*************************999.88***************8888899***************************************. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
                     +g lvg+kktLvfykgrapkgek++Wvmheyrle
  XP_010549128.1  98 TGILVGMKKTLVFYKGRAPKGEKSNWVMHEYRLE 131
                     99******************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.68E-653151IPR003441NAC domain
PROSITE profilePS5100560.1075151IPR003441NAC domain
PfamPF023655.0E-296130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MEENLPPGFR FHPTDEELIT HYLCRKVSEV GFTAKAIVEV DLNKCEPWDL PAMASMGEKE  60
WYFFSLRDRK YPTGLRTNRA TEAGYWKTTG KDKEIYRTGI LVGMKKTLVF YKGRAPKGEK  120
SNWVMHEYRL ENKNPFKPTK EEWVVCRVFE KSVAVKKPQD HHAQSSQPSL DDSPNCDTNS  180
VANDFGDIEF PNPNPNISAG IHHHHHHHHN ISSQSGNIYS GDNLNMNMNM NMANTLPLLS  240
SWMMGSTPLS PMNSALLKAF QFKNSYNFPK DSIGSSVLQH GDSNYGMIGS TSMSQNGPTS  300
HPQSQPQEQP FNMDPIW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-57415716171NO APICAL MERISTEM PROTEIN
1ut4_B2e-57415716171NO APICAL MERISTEM PROTEIN
1ut7_A2e-57415716171NO APICAL MERISTEM PROTEIN
1ut7_B2e-57415716171NO APICAL MERISTEM PROTEIN
4dul_A2e-57415716171NAC domain-containing protein 19
4dul_B2e-57415716171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00364DAPTransfer from AT3G18400Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010549128.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0266582e-62AB026658.1 Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone: MYF24.
GenBankCP0026862e-62CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010549128.10.0PREDICTED: NAC domain-containing protein 59
TrEMBLA0A078JJ371e-146A0A078JJ37_BRANA; BnaCnng55590D protein
STRINGXP_010549128.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM55272649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.11e-132NAC domain containing protein 58