PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010548704.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family CPP
Protein Properties Length: 572aa    MW: 61355.8 Da    PI: 7.4887
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010548704.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR45.41.6e-14117157142
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                     ++kk+CnCk+s+Clk+YCeCfa+g++C+  C+C++C+N+ e+
  XP_010548704.1 117 QKKKQCNCKHSRCLKLYCECFASGTYCDG-CNCTNCFNNVEN 157
                     589**************************.********9875 PP

2TCR512.8e-16202241140
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  XP_010548704.1 202 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCLDCKNYE 241
                     589***********************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.6E-15117157IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.911118242IPR005172CRC domain
PfamPF036389.8E-11119154IPR005172CRC domain
SMARTSM011141.1E-19202243IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.7E-12205240IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 572 aa     Download sequence    Send to blast
MGEGGDGGEF PPKKEQPEAS DFPVKNPARQ LDFTGGADAV LPENSHCKAS APAAVTATAV  60
KTSKAPGIGQ VRPTMPVVPL TPSSQSQVLH SSARLSKLES PKSRARPSVD ARDGTPQKKK  120
QCNCKHSRCL KLYCECFASG TYCDGCNCTN CFNNVENEAA RREAVDATLD RNPNAFRPKI  180
ASSPHGACDS REEVGEVLVL GKHNKGCHCK KSGCLKKYCE CFQANILCSE NCKCLDCKNY  240
EGSEERQALF HGGEHANNMG YLQQEAKAAI TGAVGSCGFA SSPAPKRKKS QEIIFSQATE  300
DPSVHRLSHF HQANSGISTG PMSSRSPQVP VSRASGNVSL GPSKFLYRSL LADIIQPQDV  360
KALCSVLVAV AGEAAKTLAD ERIETEKRME VQKETFLASS AQDQGQGVKA EKVETGDGKP  420
CGEDSNSEDG RPLSPTTLEL MCDEEDTMFI LAASSNASVD ADSEKTSQLP NGKGLSEIYA  480
ERERIVLTKF WDCLHRLISY GELKESNCSS FARTHRGMAA ALETEAGFNQ GPTMNGVSRP  540
STQSTTKPPL PRLTATSVQN PSNTHLHKAP QV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A5e-3211925111132Protein lin-54 homolog
5fd3_B5e-3211925111132Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010548704.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010548704.10.0PREDICTED: protein tesmin/TSO1-like CXC 5 isoform X1
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLV4MD100.0V4MD10_EUTSA; Uncharacterized protein
STRINGXP_010548704.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.10.0Tesmin/TSO1-like CXC domain-containing protein