PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010548498.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family WRKY
Protein Properties Length: 504aa    MW: 54284.1 Da    PI: 6.1263
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010548498.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY80.22.2e-25189245259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +DgynWrKYGqK+vk+ + +rsYYrCt+++C++kk +e+s++ ++v+ei+++g+H h+
  XP_010548498.1 189 RDGYNWRKYGQKQVKSPKGSRSYYRCTYSDCCAKK-IECSNDSGNVIEIVNKGSHSHD 245
                     7********************************98.*********************7 PP

2WRKY99.71.8e-31369425359
                     -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     Dgy+WrKYGqK+vkg+++pr+YYrCtsagCpv+k++e++ +++++v+itY+g Hnh+
  XP_010548498.1 369 DGYRWRKYGQKMVKGNPNPRNYYRCTSAGCPVRKHIETAVDNTTAVIITYKGVHNHD 425
                     9*******************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081116.845183247IPR003657WRKY domain
Gene3DG3DSA:2.20.25.807.8E-20185247IPR003657WRKY domain
SuperFamilySSF1182901.24E-19186247IPR003657WRKY domain
SMARTSM007744.4E-23188246IPR003657WRKY domain
PfamPF031063.4E-17190245IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.1E-31352427IPR003657WRKY domain
PROSITE profilePS5081132.237362427IPR003657WRKY domain
SuperFamilySSF1182904.58E-27363427IPR003657WRKY domain
SMARTSM007749.8E-36367426IPR003657WRKY domain
PfamPF031069.2E-24369425IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 504 aa     Download sequence    Send to blast
MSETESDGAE LVSAEAAEKG LPDSTRSDGV EPGKELGGGG GLSQLDERDR VGEFRVPDTD  60
VEALGGGEEK RETLAKDQVE GVRQNSDVES NGEEDRALKE TEGGKEVVLS GTVPVDQVAV  120
ENHESGKEAV INAIVPVDEV AVENHGVEPS PCPTPWSDPP TASATKEQRS LSRVVEGMSV  180
SPAVRTPTRD GYNWRKYGQK QVKSPKGSRS YYRCTYSDCC AKKIECSNDS GNVIEIVNKG  240
SHSHDPPRKN NYSVRESRVV SSIQPVSVDH ATAAAEGESV KLLCYTDPSI SAKENIGEPN  300
TTPERKRLSS SVSDGNGEIE AKKNHLEEPD AKRRLKKDNN TSCLDFVSKS EKKHKFVVHA  360
AGDVGVSGDG YRWRKYGQKM VKGNPNPRNY YRCTSAGCPV RKHIETAVDN TTAVIITYKG  420
VHNHDMPVPK KRHGLPSATL VAAAAPTSMN SSLAQAGEPA NPPRVASPSQ CSGGRESEMS  480
NEANEKAMES ARTLLSIGFE IKQC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A5e-25355427274WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010548498.10.0PREDICTED: probable WRKY transcription factor 32
SwissprotP595831e-166WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLV4MMR71e-171V4MMR7_EUTSA; Uncharacterized protein
STRINGAT4G30935.11e-164(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63382844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.11e-163WRKY DNA-binding protein 32