PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010547773.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 327aa    MW: 37076 Da    PI: 8.6356
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010547773.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM182.21.3e-56161411128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeel+++yL+kkv ++ +++ ++i evd++k+ePw+Lp k+k +ek+wyfF+ rd+ky+tg r+nrat++gyWkatgkdke+++ 
  XP_010547773.1  16 LPPGFRFHPTDEELITHYLHKKVLDSGFTA-KAIGEVDLNKSEPWELPWKAKMGEKDWYFFCVRDRKYPTGMRTNRATEAGYWKATGKDKEIHR- 108
                     79*************************999.89***************888999***************************************9. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                     +++lvg+kktLvfy+grapkg+kt+Wvmheyrl
  XP_010547773.1 109 GKSLVGMKKTLVFYRGRAPKGQKTNWVMHEYRL 141
                     999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.88E-6412166IPR003441NAC domain
PROSITE profilePS5100560.05316166IPR003441NAC domain
PfamPF023653.8E-3017141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
METFCGYHKE DEQMDLPPGF RFHPTDEELI THYLHKKVLD SGFTAKAIGE VDLNKSEPWE  60
LPWKAKMGEK DWYFFCVRDR KYPTGMRTNR ATEAGYWKAT GKDKEIHRGK SLVGMKKTLV  120
FYRGRAPKGQ KTNWVMHEYR LDGKLSAHNL PKTAKNEWVL CRVFQKSAGG KKIPISGLIR  180
IGSFGTGLDP SGLPPLTESS PYDQTKTEPV YVPCFSNPTE NQVSTISCFS KHVLSSIHDN  240
IVPRTPLCQN PNPAVWMQEQ PPVLRAMIEN RGRQSFKALS VSQETGVSTE INTDISSDFE  300
CGKRHFDHRG DPSSSAGPVD LESFWNY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-551317214171NO APICAL MERISTEM PROTEIN
1ut4_B2e-551317214171NO APICAL MERISTEM PROTEIN
1ut7_A2e-551317214171NO APICAL MERISTEM PROTEIN
1ut7_B2e-551317214171NO APICAL MERISTEM PROTEIN
3swm_A1e-551317217174NAC domain-containing protein 19
3swm_B1e-551317217174NAC domain-containing protein 19
3swm_C1e-551317217174NAC domain-containing protein 19
3swm_D1e-551317217174NAC domain-containing protein 19
3swp_A1e-551317217174NAC domain-containing protein 19
3swp_B1e-551317217174NAC domain-containing protein 19
3swp_C1e-551317217174NAC domain-containing protein 19
3swp_D1e-551317217174NAC domain-containing protein 19
4dul_A2e-551317214171NAC domain-containing protein 19
4dul_B2e-551317214171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010547773.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010547773.10.0PREDICTED: NAC domain-containing protein 100-like
RefseqXP_010547774.10.0PREDICTED: NAC domain-containing protein 100-like
RefseqXP_010547775.10.0PREDICTED: NAC domain-containing protein 100-like
SwissprotQ9FLJ20.0NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A178USB80.0A0A178USB8_ARATH; NAC100
STRINGXP_010547773.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40028174
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.10.0NAC domain containing protein 100
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]