PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010547435.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 280aa    MW: 32838.1 Da    PI: 7.5463
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010547435.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.41.9e-55141431129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     +ppGfrFhP++eelv +yL+kkv+++k++l +vi+e+d+yk+ePwdL++   + +++++ewyfFs++dkky+tg+r+nrat +g+Wkatg+dk+v
  XP_010547435.1  14 VPPGFRFHPKEEELVGYYLRKKVASQKIDL-DVIREIDLYKIEPWDLQErcrMGYEDQNEWYFFSHKDKKYPTGTRTNRATVAGFWKATGRDKAV 107
                     69****************************.9***************953533334667************************************ PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                     ++ k++l+g++ktLvfy+grap+g+ktdW+mheyrle
  XP_010547435.1 108 HH-KSKLIGMRKTLVFYRGRAPNGQKTDWIMHEYRLE 143
                     **.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-604163IPR003441NAC domain
PROSITE profilePS5100558.4514163IPR003441NAC domain
PfamPF023656.5E-2815142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MIMMECMEHQ SCSVPPGFRF HPKEEELVGY YLRKKVASQK IDLDVIREID LYKIEPWDLQ  60
ERCRMGYEDQ NEWYFFSHKD KKYPTGTRTN RATVAGFWKA TGRDKAVHHK SKLIGMRKTL  120
VFYRGRAPNG QKTDWIMHEY RLESEENAPP QEEGWVVCRA FKKRVQTKRS EAWEKSCFVL  180
DEAMHMPSSS SSSSSSSHYD NTLTSLCKKG FPDIDLFIQT EDRLCQKLPH QLESPSSLPP  240
LHEEDHRNND DCFTNSEKRV TDWRSLDRFV ASQLLMSGQP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-511217513174Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:25148240}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00590DAPTransfer from AT5G66300Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010547435.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010547435.10.0PREDICTED: NAC domain-containing protein 105
SwissprotQ9FH591e-119NC105_ARATH; NAC domain-containing protein 105
TrEMBLA0A2I4FKK11e-117A0A2I4FKK1_JUGRE; NAC domain-containing protein 37-like
TrEMBLQ401P01e-117Q401P0_ZINVI; NAC-domain protein Ze567
STRINGXP_010547435.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36862661
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66300.11e-120NAC domain containing protein 105
Publications ? help Back to Top
  1. Tan TT, et al.
    Transcription Factors VND1-VND3 Contribute to Cotyledon Xylem Vessel Formation.
    Plant Physiol., 2018. 176(1): p. 773-789
    [PMID:29133368]