PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010546439.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family TCP
Protein Properties Length: 333aa    MW: 34458 Da    PI: 10.623
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010546439.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP44.46e-143371241
             TCP  2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGf 41
                    a+kk +++++h+kv+gR+RR+R+++ caar+   q +LG+
  XP_010546439.1 33 AVKKPPSKDRHSKVDGRGRRIRMPIICAARVWR-QSMLGL 71
                    78*******************************.****96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.7E-93970IPR005333Transcription factor, TCP
PfamPF036340.0018150197IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MSNTDGAGNG VSNGAIIERH RQNSLSVGKG ALAVKKPPSK DRHSKVDGRG RRIRMPIICA  60
ARVWRQSMLG LGLGFCGAKI VQLSSFVLRP PTTLASAGFG HRLQHRIVSS SGPHCKTPGE  120
VPILGLEVTV IQFVLVSWFV FGIQQEDDHL LRQAEPSIIA ATGTGTTPAS FSSASMSVHG  180
GGNSMSFPST SSSLDHKPLS GPSPFILGKR VRAEEDSGGG CGGVGKDDGG VTSVGHTMGS  240
FVGSATQAGF WAVPARPDFG QVWSFSAAAG APMSASITQQ PAALFVHQQQ QAAAAMGEAS  300
AARVGNYLPG HLNLLASLSG GAARSGRREE DPR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010546439.10.0PREDICTED: LOW QUALITY PROTEIN: transcription factor TCP7
TrEMBLA0A061E2202e-81A0A061E220_THECC; TCP family transcription factor
STRINGGLYMA10G43190.11e-79(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17822685
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23280.13e-35TCP family protein