PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010546422.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family Dof
Protein Properties Length: 282aa    MW: 30679.6 Da    PI: 8.7068
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010546422.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.82.8e-391370461
          zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                    + lkcprC+st+tkfCyynnyslsqPryfCk+CrryWtkGG+lrn+PvGgg+rknkk 
  XP_010546422.1 13 HPLKCPRCESTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGTLRNIPVGGGCRKNKKP 70
                    6789****************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-31165IPR003851Zinc finger, Dof-type
PfamPF027014.3E-331469IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.0591569IPR003851Zinc finger, Dof-type
PROSITE patternPS0136101753IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MDSGRRLRPP HAHPLKCPRC ESTHTKFCYY NNYSLSQPRY FCKTCRRYWT KGGTLRNIPV  60
GGGCRKNKKP SAGKKPSSST GTATTAAAVA ATELMAPHSQ LNYENAPFGF PHFGGTMGSY  120
GQEHTGGFLE SKYGGLLQQT PRPIDFLDGK FDLMGMNSDL PMVEPGSISL THGLGINHGE  180
LHGFHGGGAG IMDITTCQRL MMTAYEHHHH HNGNDQDQNL TAMDVKPNPE LSSLDWQQGQ  240
VCPDTGKDTA SYGGYMKGLG PSWSGLMING YGPPTKKTNS LV
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Promotes expression (PubMed:19915089). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements (PubMed:30626969). Involved in the regulation of interfascicular cambium formation and vascular tissue development, particularly at a very early stage during inflorescence stem development; promotes both cambium activity and phloem specification, but prevents xylem specification (PubMed:19915089). {ECO:0000250|UniProtKB:Q9M2U1, ECO:0000269|PubMed:19915089, ECO:0000269|PubMed:30626969}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010546422.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010546422.10.0PREDICTED: dof zinc finger protein DOF5.6
SwissprotQ9FM032e-93DOF56_ARATH; Dof zinc finger protein DOF5.6
TrEMBLA0A0D3E1Y04e-95A0A0D3E1Y0_BRAOL; Uncharacterized protein
STRINGXP_010546422.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63742746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.11e-88Dof family protein
Publications ? help Back to Top
  1. Miyashima S, et al.
    Mobile PEAR transcription factors integrate positional cues to prime cambial growth.
    Nature, 2019. 565(7740): p. 490-494
    [PMID:30626969]