PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010546376.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 343aa    MW: 39585.2 Da    PI: 6.1937
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010546376.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.73.7e-5671361129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     +ppGfrFhPtdeelv++yL+kkv++k++e+ ++ik+vd+yk+ePwdL+      ++e++ewyfFs++dkky+tg+r+nratk+g+Wkatg+dk++
  XP_010546376.1   7 VPPGFRFHPTDEELVDYYLRKKVASKRIEI-DFIKDVDLYKIEPWDLNdLciIGNEEQNEWYFFSHKDKKYPTGTRTNRATKAGFWKATGRDKAI 100
                     69****************************.99**************853433334666************************************ PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                     +s +++l+g++ktLvfy+grap+g+k+dW+mheyrle
  XP_010546376.1 101 YS-RHSLIGMRKTLVFYQGRAPNGQKSDWIMHEYRLE 136
                     **.889*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.75E-615156IPR003441NAC domain
PROSITE profilePS5100559.6757156IPR003441NAC domain
PfamPF023656.4E-298135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MNSFSHVPPG FRFHPTDEEL VDYYLRKKVA SKRIEIDFIK DVDLYKIEPW DLNDLCIIGN  60
EEQNEWYFFS HKDKKYPTGT RTNRATKAGF WKATGRDKAI YSRHSLIGMR KTLVFYQGRA  120
PNGQKSDWIM HEYRLETNEN GTPQEEGWVV CRVFKKRLAA VRKMGDYEIS PTHWYDDQLS  180
FMASDLETNS PTRRILPSHH QLQPPYGLVN AAAYNLHNPN LQCKQELELQ QHYNHLPSNL  240
THGEEQMMHQ GSSSFGSLYM NNGTEQAVVD QVTDWRVLDK FVASQLSNEE ASASAQTNAK  300
DLRVDDEEMN LLESETKRVS EMGQEYAAAA ASTSSSCQID LWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-51615714169Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:16103214, PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010546376.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010546376.10.0PREDICTED: NAC domain-containing protein 7-like isoform X2
SwissprotQ9FWX20.0NAC7_ARATH; NAC domain-containing protein 7
TrEMBLR0I6E90.0R0I6E9_9BRAS; Uncharacterized protein
STRINGXP_010546359.10.0(Tarenaya hassleriana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-180NAC 007
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]