PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010544891.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 313aa    MW: 35513.5 Da    PI: 4.9344
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010544891.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM149.51.7e-4681363128
             NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                     +GfrF+Ptd+el+++yL +k  g++++++e+i+e+ i++++PwdL++  k+++ ++k wyfFs+r +ky+++kr+nr+tk+gyWk tg+d+ ++ 
  XP_010544891.1   8 KGFRFRPTDQELIKDYLDHKNLGDETPVHEAINEIIICRFDPWDLHEqsKIQSeDDKVWYFFSPRVTKYSNSKRANRKTKNGYWKVTGRDRCIKG 102
                     7***************************9****************84245555356699************************************ PP

             NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     k+++++g+kktLvfykgr p++ +t Wvmhey+ 
  XP_010544891.1 103 KNQKVIGTKKTLVFYKGRVPNAARTAWVMHEYHS 136
                     ********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100546.9276154IPR003441NAC domain
PfamPF023651.8E-258135IPR003441NAC domain
SuperFamilySSF1019418.37E-468154IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MVLKWEMKGF RFRPTDQELI KDYLDHKNLG DETPVHEAIN EIIICRFDPW DLHEQSKIQS  60
EDDKVWYFFS PRVTKYSNSK RANRKTKNGY WKVTGRDRCI KGKNQKVIGT KKTLVFYKGR  120
VPNAARTAWV MHEYHSSVVP PDKGVYVLCK VKDKSNNDNT VSSGGGAEPS HPLPCSSEDH  180
VTTEETSETI VLAEETPNSV CDFGGPDTDL GLWRDELDDG SSLSSMLMTN YSLSDYSLLP  240
EYDSPTVQLE NNEEVWGFSA DDLASSREHG LNTFMHESPI SFESFYQSDL INISEGEISP  300
AQGNCLHQQA LRI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-33915618170Stress-induced transcription factor NAC1
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010544891.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010544888.10.0PREDICTED: NAC domain-containing protein 83-like isoform X2
STRINGXP_010544888.10.0(Tarenaya hassleriana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01550.16e-47NAC domain containing protein 69