PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010544533.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family G2-like
Protein Properties Length: 261aa    MW: 29479.2 Da    PI: 10.1887
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010544533.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.64.3e-31128182155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     k+r++Wt++LH++F+++veqLGG+ekAtPk+il++m+ +gL++ hvkSHLQkYR+
  XP_010544533.1 128 KTRIKWTQDLHKQFIHCVEQLGGAEKATPKAILKMMNTDGLSILHVKSHLQKYRI 182
                     68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.277125185IPR017930Myb domain
SuperFamilySSF466893.58E-16126182IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.1E-26127182IPR009057Homeodomain-like
TIGRFAMsTIGR015577.2E-23128182IPR006447Myb domain, plants
PfamPF002496.5E-10132181IPR001005SANT/Myb domain
PfamPF143792.1E-11213257IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MNKEGLSNSE AFFSRMGTCD PFASTTSSSS SSAPRCSKGD TDDLSIIVSS QTNMFRNSNI  60
AGSIPCQDRS RSVPLGQDNV IIPHRSKTSQ NNRCEYVRIH HSSDNNGSVV KNEVTAQSSQ  120
PKASPTSKTR IKWTQDLHKQ FIHCVEQLGG AEKATPKAIL KMMNTDGLSI LHVKSHLQKY  180
RIGRHIPESL QERSSKKRDA DSIAWFGSKV GLQLMEALNQ QLDVQRSLSK QLEVQRDLQE  240
RIEEEWKKLR QMLDRQLQRQ K
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010544533.10.0PREDICTED: protein PHR1-LIKE 1-like
TrEMBLC6T3S61e-49C6T3S6_SOYBN; Putative uncharacterized protein
TrEMBLV7BIH15e-49V7BIH1_PHAVU; Uncharacterized protein
STRINGPOPTR_0016s04830.15e-48(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54762748
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.18e-46G2-like family protein