PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010544346.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 348aa    MW: 39929.5 Da    PI: 4.7699
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010544346.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.51.8e-5561331128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     lppGfrFhPtd+elv +yL +k++g+++el e+i+evd+yk+ePw+Lp k  + +++ ewyf+s+rd+ky++g+r+nrat++gyWkatgkd++v 
  XP_010544346.1   6 LPPGFRFHPTDKELVAYYLYRKISGQTIEL-EIIPEVDLYKCEPWELPdKsLLPGNDMEWYFYSPRDRKYPNGSRTNRATRAGYWKATGKDRSVQ 99 
                     79****************************.99**************95434555788************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     s +++++g+kktLv+y+grap+g +t+Wvmheyrl
  XP_010544346.1 100 S-NKRAMGMKKTLVYYRGRAPHGIRTNWVMHEYRL 133
                     9.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.32E-653156IPR003441NAC domain
PROSITE profilePS5100560.2696156IPR003441NAC domain
PfamPF023658.9E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MAPMSLPPGF RFHPTDKELV AYYLYRKISG QTIELEIIPE VDLYKCEPWE LPDKSLLPGN  60
DMEWYFYSPR DRKYPNGSRT NRATRAGYWK ATGKDRSVQS NKRAMGMKKT LVYYRGRAPH  120
GIRTNWVMHE YRLVDPASSS SSTLKDSYAL CRVIKKNIQI PKRGEENVGN VNHRENTSMR  180
ISDERFKRDE RDNMTSGEKE LEEEEEDDDH HDKIEKEDNL KLPSETSLFS EDSSNQAFLS  240
SDEANSSDNL CSPSSFPFDF SSNLFQDLQL PKPMLSSYQL PYPPLELEDF PEICMNDAAA  300
EIERSKKGDN IGDLMMHDIN GRDSSNGTLE EILSLCFSGH VDGLDSFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-61115712166NO APICAL MERISTEM PROTEIN
1ut4_B5e-61115712166NO APICAL MERISTEM PROTEIN
1ut7_A5e-61115712166NO APICAL MERISTEM PROTEIN
1ut7_B5e-61115712166NO APICAL MERISTEM PROTEIN
3swm_A5e-61115715169NAC domain-containing protein 19
3swm_B5e-61115715169NAC domain-containing protein 19
3swm_C5e-61115715169NAC domain-containing protein 19
3swm_D5e-61115715169NAC domain-containing protein 19
3swp_A5e-61115715169NAC domain-containing protein 19
3swp_B5e-61115715169NAC domain-containing protein 19
3swp_C5e-61115715169NAC domain-containing protein 19
3swp_D5e-61115715169NAC domain-containing protein 19
4dul_A5e-61115712166NAC domain-containing protein 19
4dul_B5e-61115712166NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00205DAPTransfer from AT1G54330Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010544346.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010544346.10.0PREDICTED: NAC domain-containing protein 86-like
TrEMBLA0A061FB921e-133A0A061FB92_THECC; NAC domain containing protein 20
STRINGXP_010544346.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM81232640
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54330.15e-99NAC domain containing protein 20