PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010544337.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 208aa    MW: 23665.5 Da    PI: 6.787
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010544337.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM151.63.8e-47141392128
             NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                      pGfrF+Ptd el+++yL++k++g++ ++  vi+ev+iyk+ePwdLp + + ++e+ew+fF +r ++y++g++++rat+ gyWk+tgk+++v+s 
  XP_010544337.1  14 FPGFRFSPTDVELICHYLRRKIAGDESSV-AVIPEVEIYKFEPWDLPdQLILKSESEWFFFGTRGRRYPHGSQRKRATELGYWKTTGKERNVKS- 106
                     69************************999.89***************767777889**************************************. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                     ++++vg+k+tLvf+ grap g++t W+mhey +
  XP_010544337.1 107 GSQVVGTKRTLVFHLGRAPWGQRTGWIMHEYCM 139
                     9******************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.32E-546154IPR003441NAC domain
PROSITE profilePS5100551.21313155IPR003441NAC domain
PfamPF023654.9E-2515138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MPTREALIAA SEVFPGFRFS PTDVELICHY LRRKIAGDES SVAVIPEVEI YKFEPWDLPD  60
QLILKSESEW FFFGTRGRRY PHGSQRKRAT ELGYWKTTGK ERNVKSGSQV VGTKRTLVFH  120
LGRAPWGQRT GWIMHEYCMI GAPRDELVVC RLRKNSDFQA GSSQGQMHDG KCGDTESYSW  180
SESEQKPSNH AADTNAEPSD YVETELAL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-431515419164NO APICAL MERISTEM PROTEIN
1ut4_B2e-431515419164NO APICAL MERISTEM PROTEIN
1ut7_A2e-431515419164NO APICAL MERISTEM PROTEIN
1ut7_B2e-431515419164NO APICAL MERISTEM PROTEIN
3swm_A3e-431515422167NAC domain-containing protein 19
3swm_B3e-431515422167NAC domain-containing protein 19
3swm_C3e-431515422167NAC domain-containing protein 19
3swm_D3e-431515422167NAC domain-containing protein 19
3swp_A3e-431515422167NAC domain-containing protein 19
3swp_B3e-431515422167NAC domain-containing protein 19
3swp_C3e-431515422167NAC domain-containing protein 19
3swp_D3e-431515422167NAC domain-containing protein 19
4dul_A2e-431515419164NAC domain-containing protein 19
4dul_B2e-431515419164NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP), probably via metalloprotease activity. Regulates gibberellic acid-mediated salt-responsive repression of seed germination and flowering via FT, thus delaying seed germination under high salinity conditions. {ECO:0000269|PubMed:17410378, ECO:0000269|PubMed:18363782, ECO:0000269|PubMed:19704528, ECO:0000269|PubMed:19704545}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010544337.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By high salt stress (PubMed:19704545, PubMed:17410378, PubMed:18363782, PubMed:19704528). Repressed by gibberellic acid (GA), but induced by the GA biosynthetic inhibitor paclabutrazol (PAC) (PubMed:18363782). Accumulates transiently in seeds upon imbibition (PubMed:19704545, PubMed:17410378, PubMed:18363782, PubMed:19704528). Induced by drought stress (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:17410378, ECO:0000269|PubMed:18363782, ECO:0000269|PubMed:19704528, ECO:0000269|PubMed:19704545}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010544337.11e-156PREDICTED: NAC domain-containing protein 40-like
SwissprotQ9XIN73e-91NAC40_ARATH; NAC domain-containing protein 40
TrEMBLA0A087G5N59e-93A0A087G5N5_ARAAL; Uncharacterized protein
STRINGXP_010544337.11e-156(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM104532533
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27300.11e-93NTM1-like 8
Publications ? help Back to Top
  1. Liang M, et al.
    Subcellular Distribution of NTL Transcription Factors in Arabidopsis thaliana.
    Traffic, 2015. 16(10): p. 1062-74
    [PMID:26201836]
  2. Tian H, et al.
    NTL8 Regulates Trichome Formation in Arabidopsis by Directly Activating R3 MYB Genes TRY and TCL1.
    Plant Physiol., 2017. 174(4): p. 2363-2375
    [PMID:28649093]