PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010543867.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family TALE
Protein Properties Length: 594aa    MW: 66012.8 Da    PI: 6.3948
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010543867.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.42.8e-093023342254
                     SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     ++yp+ +++  LAk++gLt +qV++WF N R +
  XP_010543867.1 302 HPYPKDSDKIMLAKQTGLTRSQVSNWFINARVR 334
                     89*****************************88 PP

2BELL112.13.2e-36174245172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     e qe+q+kka+L+ +l+eVd+rYkqy++q+++++ssFe+vag gsa+ YtslAl +iS++Fr+Lkdai++qi
  XP_010543867.1 174 EGQEIQMKKARLVIMLDEVDQRYKQYNNQMKMIVSSFEQVAGSGSARTYTSLALETISKQFRSLKDAIIGQI 245
                     579********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005746.1E-47107243IPR006563POX domain
PfamPF075266.8E-42110241IPR006563POX domain
PROSITE profilePS5007112.034275338IPR001356Homeobox domain
CDDcd000862.33E-11278339No hitNo description
SMARTSM003891.4E-9278342IPR001356Homeobox domain
SuperFamilySSF466893.76E-17279345IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-28281344IPR009057Homeodomain-like
PfamPF059202.9E-18295334IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 594 aa     Download sequence    Send to blast
MVLTNSATYV HFNSVVDQDP PPSSSSAAAS STGNLLASPH APPQRFHGYR NNNVPSAVLH  60
GFIPRVYGTP IEAAREATRA YQQGLSLSLS SEQQQKSRDS ILASNLQGFV SRSKYLMAVQ  120
ELLKEVVSVN DNKTGTENKN GISLSSKRTG DDVDEKTTGE SAGGEETGGK AAAEGQEIQM  180
KKARLVIMLD EVDQRYKQYN NQMKMIVSSF EQVAGSGSAR TYTSLALETI SKQFRSLKDA  240
IIGQIKAFSK YLGQEEPKLK FLDHNLRHGM VQQSNNAWRP QRGLPERAVT VLRAWLFDHF  300
LHPYPKDSDK IMLAKQTGLT RSQVSNWFIN ARVRLWKPMV EEMYVEETKD QDKNNDSTKE  360
KISPNVNQDE DSMPKSVGYI AKQEKIPVSE VPQNSFMNNN GHSSSISISV PLSASVSETG  420
FSILGVSEFE GNMQGNPKKL RTDELLHSPE LVPSMEMDAD KVGEVRNDNI SPRFRDEKEF  480
PFFANNTNFI GGFGPYPICE TGRFEAEEFT PSYSGNINGV SLTLGLPHCE SFSVSATHQN  540
FFPNQNIQIG RNVEMSEPNE FGASEPRTSP AAYNPINLQN QRRFLSQLLP DFVT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A8e-16284342563Homeobox protein Meis2
3k2a_B8e-16284342563Homeobox protein Meis2
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010543867.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010543867.10.0PREDICTED: BEL1-like homeodomain protein 1 isoform X1
RefseqXP_010543868.10.0PREDICTED: BEL1-like homeodomain protein 1 isoform X1
SwissprotQ9SJ561e-123BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLA0A2I4DRV50.0A0A2I4DRV5_JUGRE; BEL1-like homeodomain protein 1
STRINGXP_010543867.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50082650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-116BEL1-like homeodomain 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]