PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010543048.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family G2-like
Protein Properties Length: 144aa    MW: 15639.9 Da    PI: 9.9424
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010543048.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like72.36.9e-2391141152
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQk 52 
                     ++r++WtpeL +rF+++v +L G ++ +Pkti+++m+v+gLt+e+v+SHLQ 
  XP_010543048.1  91 RQRMVWTPELQRRFLDVVGHL-GVNNSVPKTIVQMMNVEGLTRENVASHLQN 141
                     58*******************.9****************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.87188144IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.7E-2289141IPR009057Homeodomain-like
SuperFamilySSF466891.02E-1489141IPR009057Homeodomain-like
TIGRFAMsTIGR015573.8E-2092141IPR006447Myb domain, plants
PfamPF002495.6E-793142IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 144 aa     Download sequence    Send to blast
MGQLRAKVIN GGGAVAEWEA GLPTGADLPP LYQLLIPQGL ASAFLISPQQ NPTVVDVDRA  60
SETTFSSIQN GRVSHAPSSD TKKPMTAARK RQRMVWTPEL QRRFLDVVGH LGVNNSVPKT  120
IVQMMNVEGL TRENVASHLQ NVET
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-1688140254ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010543048.11e-103PREDICTED: transcription factor LUX-like
SwissprotQ9SNB41e-39PCL1_ARATH; Transcription factor LUX
TrEMBLA0A078D6Y91e-42A0A078D6Y9_BRANA; BnaA01g19880D protein
STRINGBra033809.1-P2e-41(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15903712
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.35e-41G2-like family protein