PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010542595.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NF-YC
Protein Properties Length: 210aa    MW: 23844.4 Da    PI: 5.5507
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010542595.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC42.51.4e-131061921399
           NF-YC  13 atdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprd 99 
                     ++d k  ++P+ ri++i++ ++  + i+ +a  l+ ka e+fi  ++  ++  + + k++ ++   ++++v++ + ++fl d vp++
  XP_010542595.1 106 VEDAKLCRFPMNRIRRIMRIENVNSHITQDAVFLVNKATEMFIERFSEDAYDCSIQDKKKFIHYKHLSSVVSNEERYEFLSDYVPEK 192
                     67888899**************99************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471137.04E-19113191IPR009072Histone-fold
PfamPF008084.0E-18113176IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.104.1E-23114191IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MASSKKRKKD DKEKEKPRSN GATNMKANKK QNKVNGGGAA AVEEQEVYEI SENSTGESEE  60
IERGEKIQKS NGRSKSRNGK SVGIPKTRRK DDDDDDEEEE DGGGGVEDAK LCRFPMNRIR  120
RIMRIENVNS HITQDAVFLV NKATEMFIER FSEDAYDCSI QDKKKFIHYK HLSSVVSNEE  180
RYEFLSDYVP EKLKAEDALE QWKAAVTDAG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
148KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010542595.11e-153PREDICTED: DNA polymerase epsilon subunit C
TrEMBLQ0WP191e-67Q0WP19_ARATH; Putative uncharacterized protein At1g07980
STRINGAT1G07980.16e-62(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM111902231
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07980.14e-52nuclear factor Y, subunit C10