PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010542545.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 268aa    MW: 29990.9 Da    PI: 9.1527
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010542545.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM105.28.4e-33199453129
             NAM  53 aeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                      + +ewyf+s+rd+ky+tg r+nrat++gyWkatgkd++v++ +++lvg++ktLvfykgrapkg+ktdWvmhe+rle
  XP_010542545.1  19 VGGREWYFYSQRDRKYTTGLRTNRATATGYWKATGKDRAVKR-RDALVGMRKTLVFYKGRAPKGRKTDWVMHEFRLE 94 
                     3678*************************************9.999****************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100539.2571119IPR003441NAC domain
SuperFamilySSF1019412.48E-3816120IPR003441NAC domain
PfamPF023653.7E-152393IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MQKPLVISRY RIQKERACVG GREWYFYSQR DRKYTTGLRT NRATATGYWK ATGKDRAVKR  60
RDALVGMRKT LVFYKGRAPK GRKTDWVMHE FRLEGPFVPP KDSPDSPKED WVLCRVFYKN  120
REGANKDNMG SCSNETASAS LPPLMDSCIS LGQPDHQEPS SHIINQQVPC FSISSQTQTD  180
PSLPDLTSLV SEPKTPSKNP FPLFTDQAPT MAAGLDAFCS DQMVLRALLN QLTKIDGYLG  240
AKESESFGEG SSQSLLTEVG ISTSAWNY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-311612665171NO APICAL MERISTEM PROTEIN
1ut4_B2e-311612665171NO APICAL MERISTEM PROTEIN
1ut7_A2e-311612665171NO APICAL MERISTEM PROTEIN
1ut7_B2e-311612665171NO APICAL MERISTEM PROTEIN
3swm_A2e-311612668174NAC domain-containing protein 19
3swm_B2e-311612668174NAC domain-containing protein 19
3swm_C2e-311612668174NAC domain-containing protein 19
3swm_D2e-311612668174NAC domain-containing protein 19
3swp_A2e-311612668174NAC domain-containing protein 19
3swp_B2e-311612668174NAC domain-containing protein 19
3swp_C2e-311612668174NAC domain-containing protein 19
3swp_D2e-311612668174NAC domain-containing protein 19
4dul_A2e-311612665171NAC domain-containing protein 19
4dul_B2e-311612665171NAC domain-containing protein 19
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15560RAVKRR
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010542545.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by auxin.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010542545.10.0PREDICTED: NAC domain-containing protein 21/22 isoform X2
SwissprotQ84TE61e-118NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLA0A178W7B21e-116A0A178W7B2_ARATH; NAC1
STRINGXP_010542544.10.0(Tarenaya hassleriana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56010.11e-104NAC domain containing protein 1
Publications ? help Back to Top
  1. Le Hénanff G, et al.
    Grapevine NAC1 transcription factor as a convergent node in developmental processes, abiotic stresses, and necrotrophic/biotrophic pathogen tolerance.
    J. Exp. Bot., 2013. 64(16): p. 4877-93
    [PMID:24043850]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  4. Huo X,Wang C,Teng Y,Liu X
    Identification of miRNAs associated with dark-induced senescence in Arabidopsis.
    BMC Plant Biol., 2015. 15: p. 266
    [PMID:26530097]
  5. Chen X, et al.
    Auxin-Independent NAC Pathway Acts in Response to Explant-Specific Wounding and Promotes Root Tip Emergence during de Novo Root Organogenesis in Arabidopsis.
    Plant Physiol., 2016. 170(4): p. 2136-45
    [PMID:26850273]
  6. Liu C,Wang B,Li Z,Peng Z,Zhang J
    TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth.
    Plant Physiol., 2018. 176(1): p. 742-756
    [PMID:29122985]