PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010542367.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 324aa    MW: 37223.7 Da    PI: 7.576
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010542367.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.89e-5391381129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     +ppGfrFhPtdeel+++yLkkk++ +k+e+ ev++evd++k+ePw+L++  ++ +  ++ewyfFs++d+ky+tg+r+nrat++g+Wkatg+dk +
  XP_010542367.1   9 VPPGFRFHPTDEELLHYYLKKKISYQKFEM-EVVREVDLNKIEPWELHErcRIGStPQNEWYFFSHKDRKYPTGSRTNRATHAGFWKATGRDKCI 102
                     69****************************.99**************853433332556************************************ PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                      +   +++g++ktLvfykgrap+g+ktdW+mheyrle
  XP_010542367.1 103 RN-CYKKIGMRKTLVFYKGRAPHGQKTDWIMHEYRLE 138
                     *9.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-598160IPR003441NAC domain
PROSITE profilePS5100557.559160IPR003441NAC domain
PfamPF023657.1E-2810137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048829Biological Processroot cap development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MGSSNNGGVP PGFRFHPTDE ELLHYYLKKK ISYQKFEMEV VREVDLNKIE PWELHERCRI  60
GSTPQNEWYF FSHKDRKYPT GSRTNRATHA GFWKATGRDK CIRNCYKKIG MRKTLVFYKG  120
RAPHGQKTDW IMHEYRLEDG DDPQSNLSED GWVICRVFKK KNLFKVGNEA SSSINSSEQN  180
IHDSSHHNNV VQARSFMHRD IPYQFVRQHV SPFELNKPEL ALQYPPVPAM FQSQPMIPSS  240
HYSSCLPRDC ESAASEGIRY QQACEPGLEV GTCETGGQGE WAMLDRLVTC HMGNEDGNNS  300
SSVQPAATSQ LTLRGEMDFW GYDK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-51916215170Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Together with BRN1 and SMB, regulates cellular maturation of root cap. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. {ECO:0000269|PubMed:20197506}.