PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010542291.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family SBP
Protein Properties Length: 128aa    MW: 14482.2 Da    PI: 9.4396
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010542291.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.65.4e-4138113277
                     -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
             SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                     Cq+e+C+adl+eak+yhrrh+vCevh+ka +++v+g++qrfCqqCsrfhel efD +krsCr rLa+hnerrrk++
  XP_010542291.1  38 CQAEKCTADLTEAKQYHRRHRVCEVHAKALSAMVAGVRQRFCQQCSRFHELVEFDGAKRSCRGRLAGHNERRRKSS 113
                     **************************************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.4E-323299IPR004333Transcription factor, SBP-box
PROSITE profilePS5114130.77835112IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.53E-3737116IPR004333Transcription factor, SBP-box
PfamPF031102.6E-3238111IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 128 aa     Download sequence    Send to blast
MEGKRTQGQD KVAASYLAKE EEEEAAERAR DGVSSRLCQA EKCTADLTEA KQYHRRHRVC  60
EVHAKALSAM VAGVRQRFCQ QCSRFHELVE FDGAKRSCRG RLAGHNERRR KSSLDSSKQG  120
SDRRGITD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-3736111984squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010542291.11e-87PREDICTED: squamosa promoter-binding-like protein 5
SwissprotQ9S7585e-51SPL5_ARATH; Squamosa promoter-binding-like protein 5
TrEMBLD7KKE34e-47D7KKE3_ARALL; Squamosa promoter-binding-like protein
STRINGAT3G15270.11e-48(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15270.12e-49squamosa promoter binding protein-like 5