PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010542275.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 345aa    MW: 38209.7 Da    PI: 7.652
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010542275.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.27.9e-54211481128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeelvv+yLk+k+++ +l++ ++i+evd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk++l++
  XP_010542275.1  21 LPPGFRFHPTDEELVVHYLKRKAASVPLPV-SIIAEVDLYKFDPWELPAKASFGEEEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPILAS 114
                     79****************************.89***************998999***************************************99 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++++vg+kk Lvfy g+ pkg+ktdW+mheyrl
  XP_010542275.1 115 gGNQKVGVKKALVFYGGKPPKGVKTDWIMHEYRL 148
                     77788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.89E-6517182IPR003441NAC domain
PROSITE profilePS5100562.21321182IPR003441NAC domain
PfamPF023655.9E-2822148IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009753Biological Processresponse to jasmonic acid
GO:0045995Biological Processregulation of embryonic development
GO:0048317Biological Processseed morphogenesis
GO:0080060Biological Processintegument development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MESTDSSGGP HPPPPSQQPN LPPGFRFHPT DEELVVHYLK RKAASVPLPV SIIAEVDLYK  60
FDPWELPAKA SFGEEEWYFF SPRDRKYPNG ARPNRAATSG YWKATGTDKP ILASGGNQKV  120
GVKKALVFYG GKPPKGVKTD WIMHEYRLAD TKSINRPPGC NFGNKKNSLR LDDWVLCRIY  180
KKNNTGRHVD SDKDDMIDDM FFRQIPPSIS SGLNVSERMN FFPARFSSFG MFSDNVNDLP  240
SGLYDVGVIN SGNGNDTSMN NVANIGLNLA PSSGXRSPLP PPYWPAEEEA VAAADGSPSK  300
RFHGGECSNI TSMLAQTPPL MQHQGMLSEG LYRTSYELHG LNWYS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-7461872170NO APICAL MERISTEM PROTEIN
1ut4_B4e-7461872170NO APICAL MERISTEM PROTEIN
1ut7_A4e-7461872170NO APICAL MERISTEM PROTEIN
1ut7_B4e-7461872170NO APICAL MERISTEM PROTEIN
3swm_A5e-7491878173NAC domain-containing protein 19
3swm_B5e-7491878173NAC domain-containing protein 19
3swm_C5e-7491878173NAC domain-containing protein 19
3swm_D5e-7491878173NAC domain-containing protein 19
3swp_A5e-7491878173NAC domain-containing protein 19
3swp_B5e-7491878173NAC domain-containing protein 19
3swp_C5e-7491878173NAC domain-containing protein 19
3swp_D5e-7491878173NAC domain-containing protein 19
4dul_A4e-7461872170NAC domain-containing protein 19
4dul_B4e-7461872170NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family (Probable). Together with NAC018/NARS2, regulates embryogenesis by regulating the development and degeneration of ovule integuments, a process required for intertissue communication between the embryo and the maternal integument (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00361DAPTransfer from AT3G15510Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010542275.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By Jasmonic acid (JA). {ECO:0000269|PubMed:16805732}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010542275.10.0PREDICTED: LOW QUALITY PROTEIN: NAC transcription factor 56
SwissprotQ9LD441e-155NAC56_ARATH; NAC transcription factor 56
TrEMBLA0A178VP091e-152A0A178VP09_ARATH; NARS1
STRINGXP_010542275.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19028276
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.11e-147NAC domain containing protein 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]