PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010542182.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 668aa    MW: 74721.3 Da    PI: 5.7904
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010542182.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.55.4e-53211481128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     lp GfrF+Ptdeel+++yL+ k++g++ e+ +vi+e+d++++ePwdLp  + +k++++ew+fF++rd+ky++g+r+nrat+sgyWkatgkd+++ 
  XP_010542182.1  21 LPLGFRFRPTDEELINHYLRLKINGRDSEV-RVIPEIDVCRWEPWDLPglSVIKTDDQEWFFFCPRDRKYPSGHRSNRATDSGYWKATGKDRTIR 114
                     699************************999.99***************6448899999************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     s k+++vg+kktLvfy+grap++e+t+W+mheyr+
  XP_010542182.1 115 S-KKTAVGMKKTLVFYRGRAPRAERTSWIMHEYRA 148
                     *.8999***************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.18E-6311171IPR003441NAC domain
PROSITE profilePS5100558.16221171IPR003441NAC domain
PfamPF023654.8E-2822147IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 668 aa     Download sequence    Send to blast
MATATATATA TAMAMLSIES LPLGFRFRPT DEELINHYLR LKINGRDSEV RVIPEIDVCR  60
WEPWDLPGLS VIKTDDQEWF FFCPRDRKYP SGHRSNRATD SGYWKATGKD RTIRSKKTAV  120
GMKKTLVFYR GRAPRAERTS WIMHEYRATD KDLDGYGPGQ NPYVLCRLFH KPSDCCGTAN  180
CDELENDKST PASPKSIPDD TSPEMVQETA TSREKALKES DDAERSLADK SDDVKPNDPL  240
INGSFDNHVT TSHTEDCILG KSIVGENPFL RDIYDLYGPS FAQIDDKTIC PSQSSLGFAA  300
SHMDSLYASD FGNCDNGLHF QGGASLQDVS LTEVLDEVFG NHNVSSCDDF TKGKDIALQR  360
TIHLPGNTGM PSAVNPLFHD TAPFFDRDDV MAGAQQYVPG NELVEGQTLS GFSWSLTPLT  420
AHPLEQYGSS SYATANPCHI NSNNLEQPTV QVSFVESNVS PSSISRFKAT ARQHLPNSNF  480
FVDQGTAPRR LKLQMEKSSS DLSEEDEVQS ATSKVVDGNE RWFLDSDKTS VHEPDSHSQP  540
ADSGIQSTTR RRIHLQMRTH KPPSNSSDSV RCSKEESTGL EGEDKDPSRQ DLKLRQNHEK  600
WTKTRLLKRS LQCSSGSMFT VFLVMAVMMV ILIATWRGWF GIITKNAENN LMFHQMDWSR  660
DRHIDVVL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-451617312167NO APICAL MERISTEM PROTEIN
1ut4_B7e-451617312167NO APICAL MERISTEM PROTEIN
1ut7_A7e-451617312167NO APICAL MERISTEM PROTEIN
1ut7_B7e-451617312167NO APICAL MERISTEM PROTEIN
3swm_A8e-451617315170NAC domain-containing protein 19
3swm_B8e-451617315170NAC domain-containing protein 19
3swm_C8e-451617315170NAC domain-containing protein 19
3swm_D8e-451617315170NAC domain-containing protein 19
3swp_A8e-451617315170NAC domain-containing protein 19
3swp_B8e-451617315170NAC domain-containing protein 19
3swp_C8e-451617315170NAC domain-containing protein 19
3swp_D8e-451617315170NAC domain-containing protein 19
4dul_A7e-451617312167NAC domain-containing protein 19
4dul_B7e-451617312167NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP). {ECO:0000250|UniProtKB:Q949N0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010542182.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By cold, heat and drought stresses. {ECO:0000269|PubMed:17158162}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010542182.10.0PREDICTED: NAC domain-containing protein 14-like
SwissprotB5X5700.0NAC14_ARATH; NAC domain-containing protein 14
TrEMBLR0GV870.0R0GV87_9BRAS; Uncharacterized protein
STRINGXP_010542182.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM55942848
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G33060.10.0NAC 014