PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010541977.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 383aa    MW: 43719.1 Da    PI: 6.5059
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010541977.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.38.8e-51211491128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     +ppGfrFhPt+eel+++yL+kkv  +k++l +vi+evd++k+ePwd+++  ++ +  +++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk +
  XP_010541977.1  21 VPPGFRFHPTEEELLHYYLRKKVCYEKIDL-DVIREVDLNKLEPWDIQEkcRIGSaPQTDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKII 114
                     69****************************.9***************952433332456**********************************99 PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     +s + + +gl+ktLvfykgrap+g+k+dW+mheyrl
  XP_010541977.1 115 CS-GARRIGLRKTLVFYKGRAPHGQKSDWIMHEYRL 149
                     99.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.18E-5617185IPR003441NAC domain
PROSITE profilePS5100554.77721185IPR003441NAC domain
PfamPF023656.9E-2722149IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0010047Biological Processfruit dehiscence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MDHPLMPDSK VNLSINGQSH VPPGFRFHPT EEELLHYYLR KKVCYEKIDL DVIREVDLNK  60
LEPWDIQEKC RIGSAPQTDW YFFSHKDKKY PTGTRTNRAT AAGFWKATGR DKIICSGARR  120
IGLRKTLVFY KGRAPHGQKS DWIMHEYRLD DNFVFPTPNN GSDVLTGDSM SCNEDGWVVC  180
RVFKKKNYHK IMDSPRICLS SSVHPNKPTF HPENGNVLDQ ILLCMGRTGS DICRSEDQKT  240
NGNNIGLLGS CDDNTEDVLL HESFMQLPRL ETPKSENHPV VSENRLGKSP VQEERTGPVS  300
DWASLDRLVA WQLNNGHHRM VDMSDRDKSC LNDHPSVEED GNMIRRLNLH WHGNDEEDID  360
IWSSLTESSS SPTSLDPLGH LSI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-491818714167NO APICAL MERISTEM PROTEIN
1ut4_B2e-491818714167NO APICAL MERISTEM PROTEIN
1ut7_A2e-491818714167NO APICAL MERISTEM PROTEIN
1ut7_B2e-491818714167NO APICAL MERISTEM PROTEIN
3swm_A2e-491818717170NAC domain-containing protein 19
3swm_B2e-491818717170NAC domain-containing protein 19
3swm_C2e-491818717170NAC domain-containing protein 19
3swm_D2e-491818717170NAC domain-containing protein 19
3swp_A2e-491818717170NAC domain-containing protein 19
3swp_B2e-491818717170NAC domain-containing protein 19
3swp_C2e-491818717170NAC domain-containing protein 19
3swp_D2e-491818717170NAC domain-containing protein 19
4dul_A2e-491818714167NAC domain-containing protein 19
4dul_B2e-491818714167NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator of genes involved in biosynthesis of secondary walls. Together with NST1, required for the secondary cell wall thickening and lignification of sclerenchymatous fibers and secondary xylem vessels (tracheary elements). Seems to repress the secondary cell wall thickening of xylary fibers. May also regulate the secondary cell wall lignification of other tissues. Binds to and activates the promoter of MYB46. {ECO:0000269|PubMed:17114348, ECO:0000269|PubMed:17237351, ECO:0000269|PubMed:17333250, ECO:0000269|PubMed:17565617, ECO:0000269|PubMed:17890373}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00016PBMTransfer from AT1G32770Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010541977.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010541977.10.0PREDICTED: NAC domain-containing protein 12
SwissprotQ9LPI71e-153NAC12_ARATH; NAC domain-containing protein 12
TrEMBLR0IGT71e-157R0IGT7_9BRAS; Uncharacterized protein
STRINGXP_010541977.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM77828124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32770.11e-143NAC domain containing protein 12
Publications ? help Back to Top
  1. Zhao Q, et al.
    Pinoresinol reductase 1 impacts lignin distribution during secondary cell wall biosynthesis in Arabidopsis.
    Phytochemistry, 2015. 112: p. 170-8
    [PMID:25107662]
  2. Fernández-Pérez F,Vivar T,Pomar F,Pedreño MA,Novo-Uzal E
    Peroxidase 4 is involved in syringyl lignin formation in Arabidopsis thaliana.
    J. Plant Physiol., 2015. 175: p. 86-94
    [PMID:25506770]
  3. Sakamoto S,Mitsuda N
    Reconstitution of a secondary cell wall in a secondary cell wall-deficient Arabidopsis mutant.
    Plant Cell Physiol., 2015. 56(2): p. 299-310
    [PMID:25535195]
  4. Yuan Y,Teng Q,Zhong R,Ye ZH
    TBL3 and TBL31, Two Arabidopsis DUF231 Domain Proteins, are Required for 3-O-Monoacetylation of Xylan.
    Plant Cell Physiol., 2016. 57(1): p. 35-45
    [PMID:26556650]
  5. Huang J,Chen F,Wu S,Li J,Xu W
    Cotton GhMYB7 is predominantly expressed in developing fibers and regulates secondary cell wall biosynthesis in transgenic Arabidopsis.
    Sci China Life Sci, 2016. 59(2): p. 194-205
    [PMID:26803299]
  6. Pascual MB, et al.
    PpNAC1, a main regulator of phenylalanine biosynthesis and utilization in maritime pine.
    Plant Biotechnol. J., 2018. 16(5): p. 1094-1104
    [PMID:29055073]