PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010541410.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family G2-like
Protein Properties Length: 337aa    MW: 36742.7 Da    PI: 5.9179
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010541410.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like93.81.4e-29154206255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     +rl+Wtp+LH+rFv++v++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  XP_010541410.1 154 TRLVWTPQLHKRFVDVVAHL-GIKNAVPKTIMQLMNVEGLTRENVASHLQKYRL 206
                     79******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.258150209IPR017930Myb domain
SuperFamilySSF466892.33E-19150210IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-29152211IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-23154206IPR006447Myb domain, plants
PfamPF002496.0E-8156205IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MGEEVKMTEY EFPDDGDENE DSSGDEDRVL EWEMGLPRCE DLTPLSQPLV PPELALAFSV  60
SPERSRTIQD VNRVSQTMLS ALCYGSTGAR ASSSNNNSNS FKTTIAPEEE DQVGSSCVGS  120
DPKKQKKSDC VGGATAEEAD SGTEEPSART LKRTRLVWTP QLHKRFVDVV AHLGIKNAVP  180
KTIMQLMNVE GLTRENVASH LQKYRLYLKR MQGLTTEDPS SSDHLFSSTP VPLQSFHGGG  240
GGLQANGAAG QAGSSIPVMY GAPPQVMPMP VYGHMGMQEY HHHHQLHHNH GHDHYHHGTG  300
GPGVFESNTY MMQQKDWSGN KYGSMASYPS VGSGGER
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-19152211463ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00014PBMTransfer from AT3G46640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010541409.10.0PREDICTED: transcription factor LUX-like
RefseqXP_010541410.10.0PREDICTED: transcription factor LUX-like
SwissprotQ9SNB41e-131PCL1_ARATH; Transcription factor LUX
TrEMBLV4L4U31e-130V4L4U3_EUTSA; Uncharacterized protein
STRINGBra018204.1-P1e-122(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.21e-113G2-like family protein