PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010541267.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 244aa    MW: 27884.5 Da    PI: 8.6398
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010541267.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM134.57.4e-4251352127
             NAM   2 ppGfrFhPtdeelvveyLkkkvegkk.leleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                     ++GfrF P ++el+++yL++k+eg+   ++++vi+ vd++++eP +Lp+    ++++++++w+fF+kr++++a+g r++r+t+sgyWkatg+  +
  XP_010541267.1   5 QVGFRFYPIEDELISFYLRNKLEGHLvGTMARVIPVVDVFELEPDQLPQlageRCRGDREQWFFFVKRQEREARGGRPSRTTASGYWKATGSPGP 99 
                     68***********************94344567**************9656766666888*********************************** PP

             NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyr 127
                     v+s++++++g+kkt+vfy+grap+g+kt+W m+ey+
  XP_010541267.1 100 VFSSDNRVIGVKKTMVFYTGRAPTGRKTKWKMNEYK 135
                     ***********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.62E-444161IPR003441NAC domain
PROSITE profilePS5100545.2174161IPR003441NAC domain
PfamPF023656.2E-226135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MEEIQVGFRF YPIEDELISF YLRNKLEGHL VGTMARVIPV VDVFELEPDQ LPQLAGERCR  60
GDREQWFFFV KRQEREARGG RPSRTTASGY WKATGSPGPV FSSDNRVIGV KKTMVFYTGR  120
APTGRKTKWK MNEYKAIDGI ANMPTIPKLR HEFSLCRLYV TSGSSRAFDR RPMEAYQMEG  180
MLLSNGAEPS SRARMMGERA SSSETSYSRG DHADLPENNT TQTNSAMVDG LTQPFWEWEQ  240
LNWA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-27716620170NO APICAL MERISTEM PROTEIN
1ut4_B1e-27716620170NO APICAL MERISTEM PROTEIN
1ut7_A1e-27716620170NO APICAL MERISTEM PROTEIN
1ut7_B1e-27716620170NO APICAL MERISTEM PROTEIN
4dul_A1e-27716620170NAC domain-containing protein 19
4dul_B1e-27716620170NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010541267.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010541267.20.0PREDICTED: NAC domain-containing protein 90
SwissprotQ9FMR31e-114NAC90_ARATH; NAC domain-containing protein 90
TrEMBLV4KW251e-120V4KW25_EUTSA; Uncharacterized protein
STRINGXP_010541267.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14452893
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44350.21e-121NAC domain containing protein 61
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]