PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010541189.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family CPP
Protein Properties Length: 585aa    MW: 62497 Da    PI: 8.0852
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010541189.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR45.31.8e-14121161142
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                     ++kk+CnCk+s+Clk+YCeCfa+g++C+  C+C +C+N+ e+
  XP_010541189.1 121 QKKKQCNCKHSRCLKLYCECFASGTYCDG-CNCANCFNNVEN 161
                     589**************************.********9875 PP

2TCR512.9e-16206245140
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  XP_010541189.1 206 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCLDCKNYE 245
                     589***********************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.9E-15121161IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.889122246IPR005172CRC domain
PfamPF036381.3E-10123158IPR005172CRC domain
SMARTSM011141.1E-19206247IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.7E-12209244IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 585 aa     Download sequence    Send to blast
MGEGGDGGQF PPKKEQQETS DFPAKKPARQ LDFTGGADGV LPEHAQSNVS ATSPAAATAT  60
AMKASTAPTA AIGQVRPAMS VVAPMPPSGP QVLHAPVRLP KQESPKSRAR PAVDSRDGTP  120
QKKKQCNCKH SRCLKLYCEC FASGTYCDGC NCANCFNNVE NEAARREAVE ATLERNPNAF  180
RPKIASSPHA ARDSREEVGE VLMLGKHNKG CHCKKSGCLK KYCECFQANI LCSENCKCLD  240
CKNYEGSEER QALFHGEHGN NIAYLQQAAA NAAITGAVGS SGFASSPGPK RRKSQEIIFN  300
QATKDTSIHR LNHFQQANSG RATGPMPCTS TVPVSRASGN VSLGPSKFIY RSLLADIIQP  360
QDVKALCSVL VAVSGEAAKT LADQRNETEK RMEDRTETSL ASSTQERGKG NKSIKAEKVE  420
TGGCSSGNQA DKSRAEDSNS DGTDASKGRP LSPATLALMC DEQDTMFMVA ASPKGSVDPS  480
CGTTSELLAN GQGQSEIYGE QERIVLTKFR DCLNRLISYG ELKESNCSSL ARTHIDSPAA  540
VETEIGFHQE PVVNGVSQST AKRPSTSVPD THKPPAFVRE ERPLK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A6e-3112325511132Protein lin-54 homolog
5fd3_B6e-3112325511132Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010541189.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010541189.10.0PREDICTED: protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLV4MD100.0V4MD10_EUTSA; Uncharacterized protein
STRINGXP_010541189.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.10.0Tesmin/TSO1-like CXC domain-containing protein