PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010540319.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family G2-like
Protein Properties Length: 407aa    MW: 45875.1 Da    PI: 5.9596
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010540319.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.52.3e-31267322156
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     k+r++W+p+LH++F++a+++LGG+++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  XP_010540319.1 267 KQRRCWSPDLHRSFLNALQELGGPQVATPKQIRELMQVEGLTNDEVKSHLQKYRLH 322
                     79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-27264325IPR009057Homeodomain-like
SuperFamilySSF466891.94E-16264325IPR009057Homeodomain-like
PROSITE profilePS5129412.334264324IPR017930Myb domain
TIGRFAMsTIGR015579.4E-27267322IPR006447Myb domain, plants
PfamPF002491.1E-6269320IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 407 aa     Download sequence    Send to blast
MGSLGDELSL DLRPSFQPRT ISDFLKEVSA IGDVSERVSK LEDFVKEFEG EMKKIDGFKR  60
ELPLCMLLLN DAISFLKEET KKFSARNVGP VLEEFIPLKK RNREEEQDKD DEETEDEEEK  120
GNSTKWIKRD KETREKTNWV SSFQLWKPDY YTSNPVNRKY SDHRITCRVE SKQRNEENLT  180
NGSSSRPFLP CKGFESFSSR NGEEEISSAQ RLSLLSPAMK NGKEETGSSL GLVASLSLPS  240
SAPEVNLNAQ SVIRLPPPSL SQQTSRKQRR CWSPDLHRSF LNALQELGGP QVATPKQIRE  300
LMQVEGLTND EVKSHLQKYR LHARKLHPGN SNSSETLEKQ SVVVLGGKLW NSGENSKGSS  360
PESGSPQGPL LLAMTTTTGG DSMEEDEETK SESFSWRDHH DSKHAKA
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00193DAPTransfer from AT1G49560Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010540319.10.0PREDICTED: probable transcription factor KAN3 isoform X1
TrEMBLA5BS051e-109A5BS05_VITVI; Putative uncharacterized protein
STRINGVIT_03s0063g01060.t011e-107(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM139271824
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.12e-49G2-like family protein