PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010539972.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family M-type_MADS
Protein Properties Length: 396aa    MW: 44375.9 Da    PI: 6.4026
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010539972.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF74.58.7e-24953145
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                    kr e++snrqvt+skRr gilKKA+ELS+LCd+++ +++fs+tgk
  XP_010539972.1  9 KRLESTSNRQVTYSKRRSGILKKAKELSILCDIDIVLLMFSPTGK 53
                    689****************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004326.4E-32160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006625.553161IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.01E-27295IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-19323IPR002100Transcription factor, MADS-box
PfamPF003191.0E-201156IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-192338IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-193859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MGRVKLKIKR LESTSNRQVT YSKRRSGILK KAKELSILCD IDIVLLMFSP TGKPTLFHGE  60
HSGIEDVIAK FSQLTPQERT KRKLESLEAL KKTFKKLDHD VNINEFLGAR NKTAEVLSNQ  120
VAVLQAQITE IHRRLSCWGN IDRIENVEHL GQLEESLRNS VEKIQIHREN SRKNQLIPVG  180
CTSQFHCGIS LPLAMGGVQE AHSLSWLHDD DNQQIIIPGD PSFLLHRDMR STSTVPSLAV  240
YSGFFEHGKP EDQICNPGQF DNLGPEPSTL NELNRNGCLS LQFGEEYSYG NPFGSMSMQD  300
DDKKLDQGIE LNLQQDPSMY QSNTSFQFPH QPMGTSDHHH HNTWFPDSAC CSTSGFGQTS  360
YNQEEENGEV MILTCFGNCS KGINSGLGTG NFFSGC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A3e-15192190MEF2 CHIMERA
6byy_B3e-15192190MEF2 CHIMERA
6byy_C3e-15192190MEF2 CHIMERA
6byy_D3e-15192190MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms a heterodimer with the MADS-box protein AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010539972.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010539972.10.0PREDICTED: agamous-like MADS-box protein AGL65 isoform X1
RefseqXP_010539973.10.0PREDICTED: agamous-like MADS-box protein AGL65 isoform X1
RefseqXP_019058072.10.0PREDICTED: agamous-like MADS-box protein AGL65 isoform X1
SwissprotQ7X9I01e-153AGL65_ARATH; Agamous-like MADS-box protein AGL65
TrEMBLV4KY081e-154V4KY08_EUTSA; Uncharacterized protein
STRINGXP_010539972.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM59332543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18750.11e-155AGAMOUS-like 65
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]