PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010539313.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family bZIP
Protein Properties Length: 352aa    MW: 38262.4 Da    PI: 6.8574
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010539313.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.31.1e-10155213563
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                     kr++r + NR +A rs +RK  +i eLe+kv +L++e ++L  +l+  +     l se+
  XP_010539313.1 155 KRAKRIIANRQSAARSKERKARYILELERKVHTLQTEATTLSAQLSLFQRDTNGLSSEN 213
                     9*****************************************99998887777776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.3E-16151215IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.553153216IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.9E-10155210No hitNo description
SuperFamilySSF579593.02E-10155209No hitNo description
PfamPF001701.5E-9155213IPR004827Basic-leucine zipper domain
CDDcd147036.88E-23156205No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MEDPSKPNPS NHYRPQCPVP PSANPAAAAQ APAPTPFRGP YHRRAHSEVQ FRLPADLDLS  60
EPFGGFDDLG SEDDLFCSYM DIEKLGSGSA SDSAGPSAPR PDNPVPAENG GEARDSKPKH  120
RHSLSVDGSS TSESIEAKKA MAPDKLAELW VVDPKRAKRI IANRQSAARS KERKARYILE  180
LERKVHTLQT EATTLSAQLS LFQRDTNGLS SENTELKLRL QAMEQQAKLR DALNEALKKE  240
VDRLKFATGE MSHADAYNLG MARSCVQYPQ PPQNLQMAPQ FYVFQPNNTT SPSAHHPALV  300
TASGQSPHSN SFSDAMQQDP LGRLQGLDIS SCGRGSGFGR SDSVSESSST IN
Functional Description ? help Back to Top
Source Description
UniProtTranscrition factor that may participate with bZIP34 in the gametophytic control of pollen development. {ECO:0000269|PubMed:27896439}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00303DAPTransfer from AT2G40620Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010539313.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010539313.10.0PREDICTED: transcription factor RF2b-like
SwissprotO228731e-174BZP18_ARATH; bZIP transcription factor 18
TrEMBLA0A178VZR11e-172A0A178VZR1_ARATH; Uncharacterized protein
STRINGXP_010539313.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40422757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.11e-148bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Pawar V, et al.
    A novel family of plant nuclear envelope-associated proteins.
    J. Exp. Bot., 2016. 67(19): p. 5699-5710
    [PMID:27630107]
  3. Gibalová A, et al.
    Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte.
    Plant Reprod, 2017. 30(1): p. 1-17
    [PMID:27896439]
  4. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  5. Babiychuk E,Fuangthong M,Van Montagu M,Inzé D,Kushnir S
    Efficient gene tagging in Arabidopsis thaliana using a gene trap approach.
    Proc. Natl. Acad. Sci. U.S.A., 1997. 94(23): p. 12722-7
    [PMID:9356517]