PlantRegMap
Plant Transcription Factor Database
PlantTFDB
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010539032.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family bZIP
Protein Properties Length: 347aa    MW: 38176.6 Da    PI: 4.4609
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010539032.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.31e-10180229453
                     XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                      k+ rr  +NR AA rsR+RKk +++ Le+k+k Le e ++L   l+   
  XP_010539032.1 180 AKKRRRQLRNRDAAVRSRERKKIYLKDLETKSKYLERECMRLGRVLQCFM 229
                     6999***********************************99976666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.9E-7174241IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.9E-12174240No hitNo description
PROSITE profilePS5021710.094179236IPR004827Basic-leucine zipper domain
PfamPF001706.8E-9180236IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.63E-10181239No hitNo description
CDDcd147041.54E-18182233No hitNo description
PROSITE patternPS000360184199IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0030968Biological Processendoplasmic reticulum unfolded protein response
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MADEIDCLDL FVDDSFFLDF DVPVLSDSPV VEDFSTSSPD SVSPWIGQIE SMLMKDDDDR  60
DHQACLGSDE KLVSDFLGDI LVDSPPGGSS SVDFAAAKVS DIPIITSPAD GSGTGEFLAD  120
KESDVSDDSG CRISKKEVAD VSAEKNSAGS DNPGNESSEK ESLDGPEARD DDEEEDDSVA  180
KKRRRQLRNR DAAVRSRERK KIYLKDLETK SKYLERECMR LGRVLQCFMA ENQHLRLFLQ  240
KGHKPYDASI AKQESAVLLW ESLLLVSLLW YLWSIIICQS PQPRLGSALL PPQANVVEAS  300
DPRSVAPKGR GISSKSSSST LTDDGKSRRC KASRPRMKPE SITCFAI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1181200KRRRQLRNRDAAVRSRERKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00019PBMTransfer from AT1G42990Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010539032.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010539032.10.0PREDICTED: bZIP transcription factor 60
TrEMBLA0A1J3I0581e-70A0A1J3I058_NOCCA; BZIP transcription factor 60
STRINGXP_010539032.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46342848
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G42990.15e-43basic region/leucine zipper motif 60