PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010538892.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 325aa    MW: 37239.5 Da    PI: 7.3555
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010538892.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.97.9e-5391381129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     +ppGfrFhPt+eel+++yLkkk++ +k+e+ evi+evd++k+ePw+L++  ++ +  ++ewyfFs++d+ky+tg+r+nrat+sg+Wkatg+dk +
  XP_010538892.1   9 VPPGFRFHPTEEELLHYYLKKKLSYQKFEM-EVIREVDLNKIEPWELQErcRIGStPQNEWYFFSHKDRKYPTGSRTNRATSSGFWKATGRDKCI 102
                     69****************************.99**************963433332556************************************ PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                      +   +++g++ktLvfykgrap+g+ktdW+mheyrle
  XP_010538892.1 103 RN-CYKKIGMRKTLVFYKGRAPHGQKTDWIMHEYRLE 138
                     *9.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.59E-588161IPR003441NAC domain
PROSITE profilePS5100556.7589161IPR003441NAC domain
PfamPF023652.5E-2710137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MGWSNNGGVP PGFRFHPTEE ELLHYYLKKK LSYQKFEMEV IREVDLNKIE PWELQERCRI  60
GSTPQNEWYF FSHKDRKYPT GSRTNRATSS GFWKATGRDK CIRNCYKKIG MRKTLVFYKG  120
RAPHGQKTDW IMHEYRLEDN GDDPQANPSE DGWVVCRAFK KKNLFKVRNE EGSSINSSEQ  180
DNNGLQARGF MHRDSQYHLH QTTFELNKPE LALHYPPIST MFQSQAIIPS SHKPPPSIVY  240
DYSSGLPRDC SHESAASEGL QYGQGCEPTG LEVGTGEWAM LDRLVTYHMG NEDSSRGMTN  300
NSSSVQPDGN QLSLGGEMDF WGFAK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A9e-50916315170Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Together with BRN1 and SMB, regulates cellular maturation of root cap. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. {ECO:0000269|PubMed:20197506}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010538892.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010538892.10.0PREDICTED: protein BEARSKIN2-like
SwissprotQ9SV871e-174BRN2_ARATH; Protein BEARSKIN2
TrEMBLD7LY431e-173D7LY43_ARALL; Predicted protein
STRINGXP_010538892.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM52132648
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G10350.11e-160NAC domain containing protein 70
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Kamiya M, et al.
    Control of root cap maturation and cell detachment by BEARSKIN transcription factors in Arabidopsis.
    Development, 2016. 143(21): p. 4063-4072
    [PMID:27803060]