PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010538860.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 374aa    MW: 43111.1 Da    PI: 6.2423
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010538860.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.24.1e-50171432127
             NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     ppGfrFhPt+eel+ +yL+kk++ +k++l +vi+evd++k+ePwd+++  ++ +  +++wyfFs++dkky+tg+r+nrat +g+Wkatg+dk ++
  XP_010538860.1  17 PPGFRFHPTEEELLRYYLRKKISYEKIDL-DVIREVDLNKLEPWDIQErcRIGStPQNDWYFFSHKDKKYPTGTRTNRATVAGFWKATGRDKIIY 110
                     9****************************.9***************963433332456************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyr 127
                     s + + +gl+ktLvfykgrap+g+k+dW+mheyr
  XP_010538860.1 111 S-GLQRIGLRKTLVFYKGRAPHGQKSDWIMHEYR 143
                     *.999****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-5512180IPR003441NAC domain
PROSITE profilePS5100554.59716180IPR003441NAC domain
PfamPF023656.6E-2617143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0010047Biological Processfruit dehiscence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MEDNEVNLSI NGQSQIPPGF RFHPTEEELL RYYLRKKISY EKIDLDVIRE VDLNKLEPWD  60
IQERCRIGST PQNDWYFFSH KDKKYPTGTR TNRATVAGFW KATGRDKIIY SGLQRIGLRK  120
TLVFYKGRAP HGQKSDWIMH EYRPDDNSVA RTTNNGFDVV TGDSMNCSED GWVVCRVFKK  180
KNYQKITDSP KISSSPLNPE KPMFRNQNGN VLDQILLCMD RTGSNICGIE NQITNDNLGL  240
FGSCHENAED VLLHESFMQL PRLEAPKSEN HPVDENRLGK SPVQGERTGP VSDWASLDRL  300
VAWQLNNGHH RTVDMFYRNK SFSDDHPNFE EYGNKIQRLD LQWHNNDEDI DIWSSLTESS  360
SSLTSLDPLG HLSV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-461318214167NO APICAL MERISTEM PROTEIN
1ut4_B8e-461318214167NO APICAL MERISTEM PROTEIN
1ut7_A8e-461318214167NO APICAL MERISTEM PROTEIN
1ut7_B8e-461318214167NO APICAL MERISTEM PROTEIN
3swm_A9e-461318217170NAC domain-containing protein 19
3swm_B9e-461318217170NAC domain-containing protein 19
3swm_C9e-461318217170NAC domain-containing protein 19
3swm_D9e-461318217170NAC domain-containing protein 19
3swp_A9e-461318217170NAC domain-containing protein 19
3swp_B9e-461318217170NAC domain-containing protein 19
3swp_C9e-461318217170NAC domain-containing protein 19
3swp_D9e-461318217170NAC domain-containing protein 19
4dul_A8e-461318214167NAC domain-containing protein 19
4dul_B8e-461318214167NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator of genes involved in biosynthesis of secondary walls. Together with NST1, required for the secondary cell wall thickening and lignification of sclerenchymatous fibers and secondary xylem vessels (tracheary elements). Seems to repress the secondary cell wall thickening of xylary fibers. May also regulate the secondary cell wall lignification of other tissues. Binds to and activates the promoter of MYB46. {ECO:0000269|PubMed:17114348, ECO:0000269|PubMed:17237351, ECO:0000269|PubMed:17333250, ECO:0000269|PubMed:17565617, ECO:0000269|PubMed:17890373}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00016PBMTransfer from AT1G32770Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010538860.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010538860.10.0PREDICTED: NAC domain-containing protein 12-like
SwissprotQ9LPI71e-153NAC12_ARATH; NAC domain-containing protein 12
TrEMBLR0IGT71e-155R0IGT7_9BRAS; Uncharacterized protein
STRINGXP_010538860.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM77828124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32770.11e-154NAC domain containing protein 12
Publications ? help Back to Top
  1. Zhao Q, et al.
    Pinoresinol reductase 1 impacts lignin distribution during secondary cell wall biosynthesis in Arabidopsis.
    Phytochemistry, 2015. 112: p. 170-8
    [PMID:25107662]
  2. Fernández-Pérez F,Vivar T,Pomar F,Pedreño MA,Novo-Uzal E
    Peroxidase 4 is involved in syringyl lignin formation in Arabidopsis thaliana.
    J. Plant Physiol., 2015. 175: p. 86-94
    [PMID:25506770]
  3. Sakamoto S,Mitsuda N
    Reconstitution of a secondary cell wall in a secondary cell wall-deficient Arabidopsis mutant.
    Plant Cell Physiol., 2015. 56(2): p. 299-310
    [PMID:25535195]
  4. Yuan Y,Teng Q,Zhong R,Ye ZH
    TBL3 and TBL31, Two Arabidopsis DUF231 Domain Proteins, are Required for 3-O-Monoacetylation of Xylan.
    Plant Cell Physiol., 2016. 57(1): p. 35-45
    [PMID:26556650]
  5. Huang J,Chen F,Wu S,Li J,Xu W
    Cotton GhMYB7 is predominantly expressed in developing fibers and regulates secondary cell wall biosynthesis in transgenic Arabidopsis.
    Sci China Life Sci, 2016. 59(2): p. 194-205
    [PMID:26803299]
  6. Pascual MB, et al.
    PpNAC1, a main regulator of phenylalanine biosynthesis and utilization in maritime pine.
    Plant Biotechnol. J., 2018. 16(5): p. 1094-1104
    [PMID:29055073]