PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010538385.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family G2-like
Protein Properties Length: 356aa    MW: 40098.7 Da    PI: 7.7086
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010538385.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.23.3e-32193246255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     pr+rWt++LH+rFv+av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  XP_010538385.1 193 PRMRWTTTLHARFVHAVQLLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 246
                     9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.15E-15190246IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.0E-28191246IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-23193246IPR006447Myb domain, plants
PfamPF002492.2E-7194245IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MELFPAQPDL SLQIHPPDRK LTSTWQRRPA EEAGDLDLGF WRRALEPSDS KTDSSTEPNS  60
SPLSRFLPNC NGSDALNSFQ FQTREKEQVF QEQQNQELRH GVLLIQDLNF LRPIRGVPLY  120
QNPPPPQCFP FDPSSPCVNN LSACTNSGLQ NPNYHPNHHL QHRHHHHHHR GLMTNNQSRL  180
MPRFPAKRSM RAPRMRWTTT LHARFVHAVQ LLGGHERATP KSVLELMDVK DLTLAHVKSH  240
LQMYRTVKTT DKAAVSSGQS DVCENGSSGD NSDDWISSRD SGKHGRGLWC NSSGEVLLHG  300
MPNDTVGENT LPSQKEMDPK CSSYERISSE ERSSSSIVSA TSPSQPNLEF TLGRPQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010538385.10.0PREDICTED: probable transcription factor KAN2
SwissprotQ9C6161e-111KAN2_ARATH; Probable transcription factor KAN2
TrEMBLA0A0D2ZR211e-127A0A0D2ZR21_BRAOL; Uncharacterized protein
STRINGBra033844.1-P1e-122(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53872850
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.11e-103G2-like family protein