PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010537831.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 350aa    MW: 40165.5 Da    PI: 7.2693
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010537831.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.91.6e-52181471128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     +ppGfrFhPt+eel+ +yLkkkv+ + ++l +vi+evd++k+ePwdL++  +v +  ++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk++
  XP_010537831.1  18 VPPGFRFHPTEEELLYYYLKKKVSYEAIDL-DVIREVDLNKLEPWDLKEkcRVGSgPQNEWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKSI 111
                     69****************************.9***************952444443556************************************ PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     +  +++++gl+ktLvfy+grap+g+kt+W+mheyrl
  XP_010537831.1 112 HLGSSKKIGLRKTLVFYTGRAPHGQKTEWIMHEYRL 147
                     **********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.06E-5714167IPR003441NAC domain
PROSITE profilePS5100557.35218167IPR003441NAC domain
PfamPF023652.8E-2719147IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MEIGSSSTSL SGGGQLLVPP GFRFHPTEEE LLYYYLKKKV SYEAIDLDVI REVDLNKLEP  60
WDLKEKCRVG SGPQNEWYFF SHKDKKYPTG TRTNRATAAG FWKATGRDKS IHLGSSKKIG  120
LRKTLVFYTG RAPHGQKTEW IMHEYRLDDS ENEIQEDGWV VCRVFKKKNH FRGFHQDQED  180
HSHHYMSTDT DHHHYDHHHH NINPNPNNPS SFPHPLDHHR HHHTTHQQPL YDFANTFDHN  240
SMHLPQLFSP ESAMAAHPFV SLNTTDLQCS QNLLRLTSNS YGGDWSFLDK LLTSSSSSTN  300
IQPPTQAKHL VGTSNQAAVL TDHDLGSNVG SERFPFQYLG NEVNLLKFSK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A9e-491417111172Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription regulator. Together with BRN1 and BRN2, regulates cellular maturation of root cap. Represses stem cell-like divisions in the root cap daughter cells, and thus promotes daughter cell fate. Inhibits expression of its positive regulator FEZ in a feedback loop for controlled switches in cell division plane. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. {ECO:0000269|PubMed:19081078, ECO:0000269|PubMed:20197506}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010537831.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By FEZ in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010537831.10.0PREDICTED: protein SOMBRERO
RefseqXP_019057945.10.0PREDICTED: protein SOMBRERO
SwissprotQ9MA171e-157SMB_ARATH; Protein SOMBRERO
TrEMBLA0A0D3CVS71e-174A0A0D3CVS7_BRAOL; Uncharacterized protein
TrEMBLA0A3P6FWE51e-174A0A3P6FWE5_BRAOL; Uncharacterized protein
STRINGXP_010537831.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM66532542
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79580.34e-91NAC family protein
Publications ? help Back to Top
  1. Fendrych M, et al.
    Programmed cell death controlled by ANAC033/SOMBRERO determines root cap organ size in Arabidopsis.
    Curr. Biol., 2014. 24(9): p. 931-40
    [PMID:24726156]
  2. Bennett T,van den Toorn A,Willemsen V,Scheres B
    Precise control of plant stem cell activity through parallel regulatory inputs.
    Development, 2014. 141(21): p. 4055-64
    [PMID:25256342]
  3. Karve R,Suárez-Román F,Iyer-Pascuzzi AS
    The Transcription Factor NIN-LIKE PROTEIN7 Controls Border-Like Cell Release.
    Plant Physiol., 2016. 171(3): p. 2101-11
    [PMID:27221617]
  4. Kamiya M, et al.
    Control of root cap maturation and cell detachment by BEARSKIN transcription factors in Arabidopsis.
    Development, 2016. 143(21): p. 4063-4072
    [PMID:27803060]