PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010537819.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family G2-like
Protein Properties Length: 374aa    MW: 40908.3 Da    PI: 8.865
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010537819.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.81.2e-333589155
         G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    kprlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  XP_010537819.1 35 KPRLRWTVELHERFVDAVTQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRL 89
                    79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.3473292IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.6E-323290IPR009057Homeodomain-like
SuperFamilySSF466891.74E-163490IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-233590IPR006447Myb domain, plants
PfamPF002491.2E-73787IPR001005SANT/Myb domain
PfamPF143795.0E-25133179IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010088Biological Processphloem development
GO:0010089Biological Processxylem development
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MFHSKKPSSM SSSSHENRPM CVQGDSGLVL TTDPKPRLRW TVELHERFVD AVTQLGGPDK  60
ATPKTIMRVM GVKGLTLYHL KSHLQKFRLG KQPHKEYNDH SAKDGPRASA LDLHRNTASS  120
SGMMRHSMND NSHMVDAIRM QMEVQRRLHE QLEVQRHLQL RIEAQGKYMQ SILEKACQTL  180
AGENMAAAAA AVAGGGGGYK GNLGISSAFP ASGPPPLSFP PFQDLNIYGN TDQLDQHFRQ  240
NIENNFTTGA DTNIYLGKKG PNPFGTDVGK SMLMWPEDHL GRLHDLGLPP ASSCQLDEHQ  300
IQIQMASHVS PDLDSLSDIY NAKSGLSGDG LCEKKIEANG GKLPERPSPR RSPLSPMMNP  360
NGGMSAQGRT SPFG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010537819.10.0PREDICTED: myb family transcription factor APL-like isoform X1
SwissprotQ9SAK51e-176APL_ARATH; Myb family transcription factor APL
TrEMBLA0A0D3ARQ11e-177A0A0D3ARQ1_BRAOL; Uncharacterized protein (Fragment)
STRINGBra008411.1-P1e-175(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50442750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79430.21e-140G2-like family protein