PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010537716.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family BES1
Protein Properties Length: 309aa    MW: 33495.2 Da    PI: 8.4605
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010537716.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822183.49.9e-5721331149
          DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslq 95 
                     ++++r+ptw+ErEnnkrRERrRRa+aaki+aGLR++Gnyklpk++DnneVlkALc+eAGw+ve+DGttyrkg+kp        + + asp+ss q
  XP_010537716.1   2 TSGTRMPTWRERENNKRRERRRRAMAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAGWIVEPDGTTYRKGCKPV------ERTNYASPCSSFQ 90 
                     5899************************************************************************......4555677777777 PP

          DUF822  96 sslkssalaspvesysaspksssfpspssldsislasaasllpvlsvlslvsss 149
                             +sp +sys sp+s s+   ++l +   a+ +sl+p+l++ls++sss
  XP_010537716.1  91 --------PSPFTSYSHSPASASSSLAANLTT---ADGQSLIPWLRNLSTSSSS 133
                     ........777777777777665544444433...3446777777777765444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056871.0E-513128IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MTSGTRMPTW RERENNKRRE RRRRAMAAKI FAGLRMYGNY KLPKHCDNNE VLKALCNEAG  60
WIVEPDGTTY RKGCKPVERT NYASPCSSFQ PSPFTSYSHS PASASSSLAA NLTTADGQSL  120
IPWLRNLSTS SSSSSSSRFP YLYVPGGSIS APVTPPLSSP TARTPRMKPD FQQNNSFFFY  180
STPPSPTRQQ LVPDPEWFSG IQIPQSVPTS PTFSLVSANP FGFKEASGNN GSGGSMMWTP  240
GQSGTCSPAA IPPGSDQTAD VPMSEAVPAE FAFGGNENGL VKAWEGERIH EESGSDDLEL  300
TLGNSTTRQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00248DAPTransfer from AT1G78700Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010537716.10.0PREDICTED: BES1/BZR1 homolog protein 4
SwissprotQ9ZV881e-145BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLR0IBF21e-143R0IBF2_9BRAS; Uncharacterized protein
STRINGAT1G78700.11e-143(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19172781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.11e-138BES1/BZR1 homolog 4