PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010537223.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 362aa    MW: 41179.2 Da    PI: 6.5062
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010537223.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1652.6e-51281601129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeelv++yL+ kv +  l    +++evd++++ePw+Lp+++k +ekewyfFs rd+ky+tg r+nrat++gyWkatgkdke+   
  XP_010537223.1  28 LPPGFRFHPTDEELVSFYLASKVFNGGLFG-FHFPEVDLNRCEPWELPEMAKMGEKEWYFFSLRDRKYPTGLRTNRATAAGYWKATGKDKEISGG 121
                     79************************9766.459**************988999**************************************998 PP

             NAM  96 .....kgelvglkktLvfykgrapkgektdWvmheyrle 129
                           +el+g+kktLvfykgrap+g kt+Wvmheyrle
  XP_010537223.1 122 ggapaATELMGMKKTLVFYKGRAPRGIKTKWVMHEYRLE 160
                     666655666****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.66E-6125182IPR003441NAC domain
PROSITE profilePS5100557.53228182IPR003441NAC domain
PfamPF023656.6E-2829159IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010014Biological Processmeristem initiation
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MEIMMTMMLG VEDVMSELAG EEGRERGLPP GFRFHPTDEE LVSFYLASKV FNGGLFGFHF  60
PEVDLNRCEP WELPEMAKMG EKEWYFFSLR DRKYPTGLRT NRATAAGYWK ATGKDKEISG  120
GGGAPAATEL MGMKKTLVFY KGRAPRGIKT KWVMHEYRLE SHHISLRHSC KEEWVICRVF  180
NKSGDRKHVG FQPQLNQIHD PQQRSSSASS SSPSSSHHHH HRHHHHHHHH TLTLPPLLET  240
TPQTLTQLPS LPDHHVQSLH ENDISSNTNE LKTLINPIVT QLNSIIFSSE QDNNSSAMKP  300
EPSTLDNCSN HQNLDFCEDY YFQDTLFQEA DLSLLGLSSL SAPGDFHVMY DSPPAESWPL  360
DL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-492518512171Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for axillary meristem initiation and separation of the meristem from the main stem. May act as an inhibitor of cell division. {ECO:0000269|PubMed:12837947, ECO:0000269|PubMed:17122068}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00241DAPTransfer from AT1G76420Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010537223.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. {ECO:0000269|PubMed:16854978}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010537223.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 3
SwissprotQ9S8511e-128NAC31_ARATH; Protein CUP-SHAPED COTYLEDON 3
TrEMBLD7KTT11e-137D7KTT1_ARALL; Uncharacterized protein
STRINGXP_010537223.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40028174
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76420.18e-99NAC family protein
Publications ? help Back to Top
  1. Chen C, et al.
    Transcriptome profiling reveals roles of meristem regulators and polarity genes during fruit trichome development in cucumber (Cucumis sativus L.).
    J. Exp. Bot., 2014. 65(17): p. 4943-58
    [PMID:24962999]
  2. Gonçalves B, et al.
    A conserved role for CUP-SHAPED COTYLEDON genes during ovule development.
    Plant J., 2015. 83(4): p. 732-42
    [PMID:26119568]
  3. Balkunde R,Kitagawa M,Xu XM,Wang J,Jackson D
    SHOOT MERISTEMLESS trafficking controls axillary meristem formation, meristem size and organ boundaries in Arabidopsis.
    Plant J., 2017. 90(3): p. 435-446
    [PMID:28161901]
  4. Espinosa-Ruiz A, et al.
    TOPLESS mediates brassinosteroid control of shoot boundaries and root meristem development in Arabidopsis thaliana.
    Development, 2017. 144(9): p. 1619-1628
    [PMID:28320734]
  5. Koyama T,Sato F,Ohme-Takagi M
    Roles of miR319 and TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2017. 175(2): p. 874-885
    [PMID:28842549]