PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010536266.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 175aa    MW: 20724.9 Da    PI: 9.4078
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010536266.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM132.23.6e-41241482127
             NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     p+G rF Ptdeelv  yLk+k+e ++l++ ++i +v+iy+++P++L +++++ ++ ewyfF++rdkky++  r+nr++  g+Wka+gk   v+  
  XP_010536266.1  24 PAGWRFAPTDEELVFLYLKPKIELQPLPM-HMIMDVNIYNHHPETLSAEYEKfNDGEWYFFTPRDKKYPKTYRPNRKAIGGFWKASGKYAGVYL- 116
                     89***************************.89**************9654443777********************9999**************. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyr 127
                     +g+++g k+ +vfy+g++p+++ktdW+m+ey 
  XP_010536266.1 117 DGREIGKKRLMVFYNGNHPNSKKTDWLMKEYC 148
                     999****************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.97E-4621155IPR003441NAC domain
PROSITE profilePS5100541.5823173IPR003441NAC domain
PfamPF023654.3E-2124148IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MPNRWRARAT EADPEILDFL SKIPAGWRFA PTDEELVFLY LKPKIELQPL PMHMIMDVNI  60
YNHHPETLSA EYEKFNDGEW YFFTPRDKKY PKTYRPNRKA IGGFWKASGK YAGVYLDGRE  120
IGKKRLMVFY NGNHPNSKKT DWLMKEYCCT VATPPPRQET DQENDMQVRV LIKKM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-322314715138Stress-induced transcription factor NAC1
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010536266.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010536266.11e-130PREDICTED: NAC transcription factor 25-like
STRINGXP_010536266.11e-130(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1887468
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.19e-37NAC domain containing protein 25