PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010535590.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family ARF
Protein Properties Length: 805aa    MW: 89191.6 Da    PI: 7.0381
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010535590.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B376.33.5e-24176277199
                     EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                     f+k+lt sd++++g +++p++ ae++      ++++ s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv++++L +gD v+F   + +++
  XP_010535590.1 176 FCKTLTASDTSTHGGFSVPRRAAEDCfppldHSQQRPSQELVAKDLHGVEWRFRHIYRGQPRRHLLTTGWSIFVSQKNLVSGDAVLFL--RGEDG 268
                     99****************************956666778*************************************************..44999 PP

                     ..EEEEE-S CS
              B3  91 elvvkvfrk 99 
                     el+++++r+
  XP_010535590.1 269 ELRLGIRRA 277
                     9*****996 PP

2Auxin_resp120.51.3e-39301382182
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                     +a+a+s++s+F+v+Y+Pra++seF +++ek++++++++vs+G+Rf+m++e++d++err++G+v+g+sdldp+rWpnSkWr+L
  XP_010535590.1 301 VANAVSSRSMFHVFYSPRATHSEFLIPYEKYMASIRNPVSIGTRFRMRYEMDDCPERRCTGVVTGISDLDPYRWPNSKWRCL 382
                     689******************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.0E-41167288IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019369.55E-44170286IPR015300DNA-binding pseudobarrel domain
CDDcd100176.61E-23174276No hitNo description
PROSITE profilePS5086313.267176278IPR003340B3 DNA binding domain
PfamPF023622.2E-22176277IPR003340B3 DNA binding domain
SMARTSM010194.9E-24176278IPR003340B3 DNA binding domain
PfamPF065073.4E-33301382IPR010525Auxin response factor
SuperFamilySSF542772.11E-10673756No hitNo description
PROSITE profilePS5174523.209678760IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0010050Biological Processvegetative phase change
GO:0010158Biological Processabaxial cell fate specification
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 805 aa     Download sequence    Send to blast
MNFSSEGFME FDLNREAVSV EGKNGGGGLE RGSSGNSSSS SSSCSSGSTP SSASASSIYS  60
ELWHACAGPL TSLPKKGNVV VYFPQGHLEQ GVMVSSSSTL SPLEIPKFDL QPQIFCRVVN  120
IQLLANKETD EVYTQLTLLP QQEQAVLNME RKETGELGGD EERNGSSSTK RTPHMFCKTL  180
TASDTSTHGG FSVPRRAAED CFPPLDHSQQ RPSQELVAKD LHGVEWRFRH IYRGQPRRHL  240
LTTGWSIFVS QKNLVSGDAV LFLRGEDGEL RLGIRRAARP KHGLPNSIVE KNSCSNILSL  300
VANAVSSRSM FHVFYSPRAT HSEFLIPYEK YMASIRNPVS IGTRFRMRYE MDDCPERRCT  360
GVVTGISDLD PYRWPNSKWR CLLVRWDESF MSGHQERVSP WEMDPSASLP PLSIQQSPRP  420
KRSRTGLLEV LPVNPVMAER GAFSVFEESI RPSEVLQGQE NIGFASHLHG CDVMNRRKLD  480
IAMPSHANPV LVSTGMKAKF GEFIGATTTR AYSGILDLER FPRVLQGQEI CSVRSFPQAA  540
AFNAPSWGAP ITGCNNNPFA YQANKSSFYP LASQGLRSTG IPFHNLYNVG EVPSRWHRDM  600
MNSPRETEAL GNVIQNLGIQ NERVLPEKVP TASGLKTAMV SRQKGDDFNG KVPSGCKLFG  660
FSLPVETQAS NPQNSSKRIC TKVHKQGSLV GRAIDLSRLN GYDDLLTELE RLFSMEGLLR  720
DPDKGWRILY TDSENDMMVV GDDPWLDFCN VVVKIHIYTK EEVEKMNVGH VNDDNQSCLE  780
EAALMVEASK SSSVSQPDFS PDSSN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldy_A1e-116404052354Auxin response factor 1
4ldy_B1e-116404052354Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010535590.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010535590.10.0PREDICTED: auxin response factor 4-like isoform X1
SwissprotQ9ZTX90.0ARFD_ARATH; Auxin response factor 4
TrEMBLA0A087GCH40.0A0A087GCH4_ARAAL; Auxin response factor
STRINGXP_010535590.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM95302636
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60450.10.0auxin response factor 4
Publications ? help Back to Top
  1. Ozerova LV,Krasnikova MS,Troitsky AV,Solovyev AG,Morozov SY
    TAS3 Genes for small ta-siARF RNAs in plants belonging to subtribe Senecioninae: occurrence of prematurely terminated RNA precursors.
    Mol. Gen. Mikrobiol. Virusol., 2013.
    [PMID:24003511]
  2. Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y
    The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis.
    Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71
    [PMID:26108442]
  3. Pashkovskiy PP,Kartashov AV,Zlobin IE,Pogosyan SI,Kuznetsov VV
    Blue light alters miR167 expression and microRNA-targeted auxin response factor genes in Arabidopsis thaliana plants.
    Plant Physiol. Biochem., 2016. 104: p. 146-54
    [PMID:27031426]
  4. Matsumura Y, et al.
    A genetic link between epigenetic repressor AS1-AS2 and a putative small subunit processome in leaf polarity establishment of Arabidopsis.
    Biol Open, 2016. 5(7): p. 942-54
    [PMID:27334696]
  5. Guan C, et al.
    Spatial Auxin Signaling Controls Leaf Flattening in Arabidopsis.
    Curr. Biol., 2017. 27(19): p. 2940-2950.e4
    [PMID:28943086]
  6. Liu Z, et al.
    ARF2-ARF4 and ARF5 are Essential for Female and Male Gametophyte Development in Arabidopsis.
    Plant Cell Physiol., 2018. 59(1): p. 179-189
    [PMID:29145642]