PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010535244.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family M-type_MADS
Protein Properties Length: 164aa    MW: 18762.8 Da    PI: 9.2297
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010535244.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF47.32.6e-151151343
                    --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
          SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                    i n s r vtf kR+ g++KK +EL +LC++ ++ ii+s  
  XP_010535244.1 11 IRNGSIRRVTFKKRKVGLFKKLSELTILCGIPACAIIYSDY 51
                    89999*********************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006617.479150IPR002100Transcription factor, MADS-box
SMARTSM004321.9E-15161IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.98E-22295IPR002100Transcription factor, MADS-box
CDDcd002661.11E-20286No hitNo description
PRINTSPR004041.2E-7323IPR002100Transcription factor, MADS-box
PfamPF003192.1E-141151IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-72338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MGRGKLNHEL IRNGSIRRVT FKKRKVGLFK KLSELTILCG IPACAIIYSD YNDDEAEVWP  60
NRREANAILD RLHRLPTAKQ TKNMLDQGGF LQKMIGKMER ELEREQKKNR CYELGLVVFH  120
NDLIDADYSE ELAVAARVLE QRIKAVTERV EAAMAVNSLC LMSA
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010535244.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010535244.11e-119PREDICTED: agamous-like MADS-box protein AGL80
RefseqXP_010535250.11e-119PREDICTED: agamous-like MADS-box protein AGL80
RefseqXP_010535253.11e-119PREDICTED: agamous-like MADS-box protein AGL80
RefseqXP_010535258.11e-119PREDICTED: agamous-like MADS-box protein AGL80
RefseqXP_019057738.11e-119PREDICTED: agamous-like MADS-box protein AGL80
TrEMBLA0A087HQF05e-53A0A087HQF0_ARAAL; Uncharacterized protein
STRINGXP_010535244.11e-118(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22590.22e-54AGAMOUS-like 87