PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010535217.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 173aa    MW: 20447 Da    PI: 10.087
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010535217.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM149.51.6e-4661271128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     lppGfrFh        +yL +k++g+++el e+i+evd+yk+ePwdLp k  + +++ ewyf+s+rdkky++g+r+nrat+ gyWkatgkd++v+
  XP_010535217.1   6 LPPGFRFH------XAYYLDRKINGRDIEL-EIIPEVDLYKCEPWDLPdKsFLPGNDMEWYFYSPRDKKYPNGSRTNRATRGGYWKATGKDRAVH 93 
                     69999999......479*************.99**************96434555788************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     s +++++g+kktLv+y+gra++g++t+Wvmheyrl
  XP_010535217.1  94 S-NKRAMGMKKTLVYYRGRAQHGTRTNWVMHEYRL 127
                     *.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100548.1881148IPR003441NAC domain
SuperFamilySSF1019415.62E-573149IPR003441NAC domain
PfamPF023651.3E-198127IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MAPMSLPPGF RFHXAYYLDR KINGRDIELE IIPEVDLYKC EPWDLPDKSF LPGNDMEWYF  60
YSPRDKKYPN GSRTNRATRG GYWKATGKDR AVHSNKRAMG MKKTLVYYRG RAQHGTRTNW  120
VMHEYRLTDP ASSSTLKDSY ALCRVFKKNK EENVGIDDQI KRVDIPKRRQ ERE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-53114912166NO APICAL MERISTEM PROTEIN
1ut4_B9e-53114912166NO APICAL MERISTEM PROTEIN
1ut7_A9e-53114912166NO APICAL MERISTEM PROTEIN
1ut7_B9e-53114912166NO APICAL MERISTEM PROTEIN
3swm_A9e-53114915169NAC domain-containing protein 19
3swm_B9e-53114915169NAC domain-containing protein 19
3swm_C9e-53114915169NAC domain-containing protein 19
3swm_D9e-53114915169NAC domain-containing protein 19
3swp_A9e-53114915169NAC domain-containing protein 19
3swp_B9e-53114915169NAC domain-containing protein 19
3swp_C9e-53114915169NAC domain-containing protein 19
3swp_D9e-53114915169NAC domain-containing protein 19
4dul_A9e-53114912166NAC domain-containing protein 19
4dul_B9e-53114912166NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010535217.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010535217.11e-127PREDICTED: LOW QUALITY PROTEIN: NAC domain-containing protein 86
SwissprotQ9FFI55e-76NAC86_ARATH; NAC domain-containing protein 86
TrEMBLA0A067F2E69e-91A0A067F2E6_CITSI; Uncharacterized protein (Fragment)
TrEMBLA0A314UQ032e-90A0A314UQ03_PRUYE; NAC domain-containing protein 86
STRINGXP_010535217.11e-127(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM81232640
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54330.12e-88NAC domain containing protein 20
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]