PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010535118.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 339aa    MW: 38310.2 Da    PI: 8.5611
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010535118.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.21.5e-53181451128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeelvv+yLk+k+++ +l++  +i++vd+yk++Pw+Lp+k+  +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk+vls+
  XP_010535118.1  18 LPPGFRFHPTDEELVVHYLKRKAASAPLPV-AIIADVDLYKFDPWELPAKAWFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLSS 111
                     79****************************.88***************8878899***************************************9 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++++vg+kk Lvfy g+ pkg+ktdWvmheyrl
  XP_010535118.1 112 gGTHKVGVKKALVFYGGKPPKGVKTDWVMHEYRL 145
                     77788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.88E-6514180IPR003441NAC domain
PROSITE profilePS5100561.78118179IPR003441NAC domain
PfamPF023652.3E-2819145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MESTDSSGGP PPPQQPNLPP GFRFHPTDEE LVVHYLKRKA ASAPLPVAII ADVDLYKFDP  60
WELPAKAWFG EQEWYFFSPR DRKYPNGARP NRAATSGYWK ATGTDKPVLS SGGTHKVGVK  120
KALVFYGGKP PKGVKTDWVM HEYRLVENKS SNRHPGYDFG NKKQSLRLDD WVLCRIYKKN  180
NTGRHVDNDK DDMIDDMNMI FRQFQPPPSI SSGRMNFFPA RVSNFGTFSD NVINSTIDVT  240
DTNAGLDLAS PSYGSKPELP MMMTATSLKR DLPRPYWPRM AAEEEETVDG SSPSKRFHGG  300
ECSNITPMFA QTPPLMQQEM LSEGLYRTSY QLHGLNWYS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-741718114170Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family (Probable). Together with NAC018/NARS2, regulates embryogenesis by regulating the development and degeneration of ovule integuments, a process required for intertissue communication between the embryo and the maternal integument (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010535118.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By Jasmonic acid (JA). {ECO:0000269|PubMed:16805732}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010535118.10.0PREDICTED: NAC transcription factor 56-like
SwissprotQ9LD441e-143NAC56_ARATH; NAC transcription factor 56
TrEMBLD7L4U41e-142D7L4U4_ARALL; ATNAC2
STRINGXP_010535118.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19028276
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.11e-138NAC domain containing protein 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]