PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010535117.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 296aa    MW: 33027.9 Da    PI: 8.8096
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010535117.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.86.4e-51141391128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrF Ptdeel+v+yL++kv+g+ ++l ++i+++d+y+++Pw Lp+k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk + + 
  XP_010535117.1  14 LPPGFRFYPTDEELMVQYLCRKVAGHIFSL-QIIADIDLYNFDPWILPSKAIFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKIIST- 106
                     79*************************999.89***************7777799*********************************999988. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                     +g+ vg+kk+Lvfy g+apkg+kt+W+mheyrl
  XP_010535117.1 107 EGRRVGIKKSLVFYVGKAPKGTKTNWIMHEYRL 139
                     9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-5810148IPR003441NAC domain
PROSITE profilePS5100553.60714169IPR003441NAC domain
PfamPF023652.3E-2615139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MGITETDPLT RLSLPPGFRF YPTDEELMVQ YLCRKVAGHI FSLQIIADID LYNFDPWILP  60
SKAIFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKIISTEGRR VGIKKSLVFY  120
VGKAPKGTKT NWIMHEYRLV EPSRKNGSSK SSGGQRQVHN NVLTDREYSN NGPSISSLSQ  180
FNNDHSFIFP GSNRSIPVLT EQKTGFINNL DWASLATTHS SVPELGPSPG YDDGFFHLKT  240
DEEVESGYRT QWAENAASAS GMLQFGSGAL TRGFGVNSID GFGFRYPGQP GGFEFM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-9911504153NO APICAL MERISTEM PROTEIN
1ut4_B1e-9911504153NO APICAL MERISTEM PROTEIN
1ut7_A1e-9911504153NO APICAL MERISTEM PROTEIN
1ut7_B1e-9911504153NO APICAL MERISTEM PROTEIN
3swm_A2e-9911507156NAC domain-containing protein 19
3swm_B2e-9911507156NAC domain-containing protein 19
3swm_C2e-9911507156NAC domain-containing protein 19
3swm_D2e-9911507156NAC domain-containing protein 19
3swp_A2e-9911507156NAC domain-containing protein 19
3swp_B2e-9911507156NAC domain-containing protein 19
3swp_C2e-9911507156NAC domain-containing protein 19
3swp_D2e-9911507156NAC domain-containing protein 19
4dul_A1e-9911504153NAC domain-containing protein 19
4dul_B1e-9911504153NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factors that bind specifically to the 5'-CATGTG-3' motif. {ECO:0000269|PubMed:15319476}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010535117.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought, high salinity and abscisic acid (ABA). Slightly up-regulated by jasmonic acid. Not induced by cold treatment. {ECO:0000269|PubMed:12646039, ECO:0000269|PubMed:15319476}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010535117.10.0PREDICTED: NAC domain-containing protein 19-like isoform X2
SwissprotQ9C9321e-119NAC19_ARATH; NAC domain-containing protein 19
TrEMBLA0A061F7J61e-120A0A061F7J6_THECC; NAC domain class transcription factor isoform 1
STRINGXP_010535116.10.0(Tarenaya hassleriana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G52890.11e-112NAC domain containing protein 19
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Zheng XY, et al.
    Coronatine promotes Pseudomonas syringae virulence in plants by activating a signaling cascade that inhibits salicylic acid accumulation.
    Cell Host Microbe, 2012. 11(6): p. 587-96
    [PMID:22704619]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Guan Q,Yue X,Zeng H,Zhu J
    The protein phosphatase RCF2 and its interacting partner NAC019 are critical for heat stress-responsive gene regulation and thermotolerance in Arabidopsis.
    Plant Cell, 2014. 26(1): p. 438-53
    [PMID:24415771]
  5. Chen F, et al.
    Arabidopsis Phytochrome A Directly Targets Numerous Promoters for Individualized Modulation of Genes in a Wide Range of Pathways.
    Plant Cell, 2014. 26(5): p. 1949-1966
    [PMID:24794133]
  6. Wang T, et al.
    Salt-Related MYB1 Coordinates Abscisic Acid Biosynthesis and Signaling during Salt Stress in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1027-41
    [PMID:26243618]
  7. Zhu X, et al.
    Jasmonic acid promotes degreening via MYC2/3/4- and ANAC019/055/072-mediated regulation of major chlorophyll catabolic genes.
    Plant J., 2015. 84(3): p. 597-610
    [PMID:26407000]
  8. Takasaki H, et al.
    SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence.
    Plant J., 2015. 84(6): p. 1114-23
    [PMID:26518251]
  9. Gimenez-Ibanez S, et al.
    JAZ2 controls stomata dynamics during bacterial invasion.
    New Phytol., 2017. 213(3): p. 1378-1392
    [PMID:28005270]
  10. Ueda M, et al.
    The Distinct Roles of Class I and II RPD3-Like Histone Deacetylases in Salinity Stress Response.
    Plant Physiol., 2017. 175(4): p. 1760-1773
    [PMID:29018096]
  11. Kang M, et al.
    The C-Domain of the NAC Transcription Factor ANAC019 Is Necessary for pH-Tuned DNA Binding through a Histidine Switch in the N-Domain.
    Cell Rep, 2018. 22(5): p. 1141-1150
    [PMID:29386103]
  12. Sukiran NL,Ma JC,Ma H,Su Z
    ANAC019 is required for recovery of reproductive development under drought stress in Arabidopsis.
    Plant Mol. Biol., 2019. 99(1-2): p. 161-174
    [PMID:30604322]