PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010535116.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 308aa    MW: 34562.7 Da    PI: 8.1839
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010535116.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.67e-51141391128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrF Ptdeel+v+yL++kv+g+ ++l ++i+++d+y+++Pw Lp+k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk + + 
  XP_010535116.1  14 LPPGFRFYPTDEELMVQYLCRKVAGHIFSL-QIIADIDLYNFDPWILPSKAIFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKIIST- 106
                     79*************************999.89***************7777799*********************************999988. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                     +g+ vg+kk+Lvfy g+apkg+kt+W+mheyrl
  XP_010535116.1 107 EGRRVGIKKSLVFYVGKAPKGTKTNWIMHEYRL 139
                     9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.22E-6410162IPR003441NAC domain
PROSITE profilePS5100559.80114162IPR003441NAC domain
PfamPF023652.5E-2615139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MGITETDPLT RLSLPPGFRF YPTDEELMVQ YLCRKVAGHI FSLQIIADID LYNFDPWILP  60
SKAIFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKIISTEGRR VGIKKSLVFY  120
VGKAPKGTKT NWIMHEYRLV EPSRKNGSSK LDDWVLCRIY EKSSGGQRQV HNNVLTDREY  180
SNNGPSISSL SQFNNDHSFI FPGSNRSIPV LTEQKTGFIN NLDWASLATT HSSVPELGPS  240
PGYDDGFFHL KTDEEVESGY RTQWAENAAS ASGMLQFGSG ALTRGFGVNS IDGFGFRYPG  300
QPGGFEFM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-11111684171NO APICAL MERISTEM PROTEIN
1ut4_B1e-11111684171NO APICAL MERISTEM PROTEIN
1ut7_A1e-11111684171NO APICAL MERISTEM PROTEIN
1ut7_B1e-11111684171NO APICAL MERISTEM PROTEIN
3swm_A1e-11111687174NAC domain-containing protein 19
3swm_B1e-11111687174NAC domain-containing protein 19
3swm_C1e-11111687174NAC domain-containing protein 19
3swm_D1e-11111687174NAC domain-containing protein 19
3swp_A1e-11111687174NAC domain-containing protein 19
3swp_B1e-11111687174NAC domain-containing protein 19
3swp_C1e-11111687174NAC domain-containing protein 19
3swp_D1e-11111687174NAC domain-containing protein 19
4dul_A1e-11111684171NAC domain-containing protein 19
4dul_B1e-11111684171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factors that bind specifically to the 5'-CATGTG-3' motif. {ECO:0000269|PubMed:15319476}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010535116.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought, high salinity and abscisic acid (ABA). Slightly up-regulated by jasmonic acid. Not induced by cold treatment. {ECO:0000269|PubMed:12646039, ECO:0000269|PubMed:15319476}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010535116.10.0PREDICTED: NAC domain-containing protein 19-like isoform X1
SwissprotQ9C9321e-132NAC19_ARATH; NAC domain-containing protein 19
TrEMBLA0A061F7J61e-133A0A061F7J6_THECC; NAC domain class transcription factor isoform 1
STRINGXP_010535116.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14352795
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G52890.11e-135NAC domain containing protein 19
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Zheng XY, et al.
    Coronatine promotes Pseudomonas syringae virulence in plants by activating a signaling cascade that inhibits salicylic acid accumulation.
    Cell Host Microbe, 2012. 11(6): p. 587-96
    [PMID:22704619]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Guan Q,Yue X,Zeng H,Zhu J
    The protein phosphatase RCF2 and its interacting partner NAC019 are critical for heat stress-responsive gene regulation and thermotolerance in Arabidopsis.
    Plant Cell, 2014. 26(1): p. 438-53
    [PMID:24415771]
  5. Chen F, et al.
    Arabidopsis Phytochrome A Directly Targets Numerous Promoters for Individualized Modulation of Genes in a Wide Range of Pathways.
    Plant Cell, 2014. 26(5): p. 1949-1966
    [PMID:24794133]
  6. Wang T, et al.
    Salt-Related MYB1 Coordinates Abscisic Acid Biosynthesis and Signaling during Salt Stress in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1027-41
    [PMID:26243618]
  7. Zhu X, et al.
    Jasmonic acid promotes degreening via MYC2/3/4- and ANAC019/055/072-mediated regulation of major chlorophyll catabolic genes.
    Plant J., 2015. 84(3): p. 597-610
    [PMID:26407000]
  8. Takasaki H, et al.
    SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence.
    Plant J., 2015. 84(6): p. 1114-23
    [PMID:26518251]
  9. Gimenez-Ibanez S, et al.
    JAZ2 controls stomata dynamics during bacterial invasion.
    New Phytol., 2017. 213(3): p. 1378-1392
    [PMID:28005270]
  10. Ueda M, et al.
    The Distinct Roles of Class I and II RPD3-Like Histone Deacetylases in Salinity Stress Response.
    Plant Physiol., 2017. 175(4): p. 1760-1773
    [PMID:29018096]
  11. Kang M, et al.
    The C-Domain of the NAC Transcription Factor ANAC019 Is Necessary for pH-Tuned DNA Binding through a Histidine Switch in the N-Domain.
    Cell Rep, 2018. 22(5): p. 1141-1150
    [PMID:29386103]
  12. Sukiran NL,Ma JC,Ma H,Su Z
    ANAC019 is required for recovery of reproductive development under drought stress in Arabidopsis.
    Plant Mol. Biol., 2019. 99(1-2): p. 161-174
    [PMID:30604322]