PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010534783.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family G2-like
Protein Properties Length: 450aa    MW: 49850.3 Da    PI: 6.8381
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010534783.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.53.1e-33240294155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     kpr+rWtpeLHerFv+av++L G+ekAtPk++l+lm+v+gLt++hvkSHLQkYRl
  XP_010534783.1 240 KPRMRWTPELHERFVQAVHSLEGPEKATPKAVLKLMNVEGLTIYHVKSHLQKYRL 294
                     79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.424237297IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.1E-32238295IPR009057Homeodomain-like
SuperFamilySSF466895.73E-18238294IPR009057Homeodomain-like
TIGRFAMsTIGR015576.1E-25240295IPR006447Myb domain, plants
PfamPF002491.6E-10242293IPR001005SANT/Myb domain
PfamPF143795.8E-23330377IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 450 aa     Download sequence    Send to blast
MNSHSLVSGT ADEGGVGQDC SSSISLVHNF LNFPPETRKA PSPFIRSQSP DSASHDHHPW  60
MKHGSKSTFS RSSSFCTNLY LSSSSSSETR KHLGNSLLPF LPNPSTYNQT ASAVESAKSP  120
AIFSEDIVTV TPPYNGGGSS SSGSLAKDFF NLPKDTCSDG GFHDLGCPND SFSLSEQMEL  180
QFLSDELELA ITDRAETPSL DEIYEMPMAM SNPGTEVSPR QNCVSAVMSH SSPGAATNQK  240
PRMRWTPELH ERFVQAVHSL EGPEKATPKA VLKLMNVEGL TIYHVKSHLQ KYRLAKYIPE  300
KREEKKNSNS EEKKSASSNS ETDGRKKGAI QITEALRMQM EVQKQLHEQL EVQRVLQLRI  360
EEHARYLQRM LEEQQKSGAL ITSSETLSSP TKSKQESSPQ LSSPTKNKAE EENSPKRHRI  420
DNKASESGEE NSPKRPRLDN KASESEERVR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00354DAPTransfer from AT3G13040Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010534781.10.0PREDICTED: uncharacterized protein LOC104810280
RefseqXP_010534782.10.0PREDICTED: uncharacterized protein LOC104810280
RefseqXP_010534783.10.0PREDICTED: uncharacterized protein LOC104810280
RefseqXP_010534785.10.0PREDICTED: uncharacterized protein LOC104810280
RefseqXP_010534786.10.0PREDICTED: uncharacterized protein LOC104810280
TrEMBLR0HYE10.0R0HYE1_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.3__1373__AT3G13040.10.0(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.21e-160G2-like family protein