PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010534777.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family G2-like
Protein Properties Length: 274aa    MW: 31157.5 Da    PI: 8.1477
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010534777.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.76.1e-343185155
         G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    kprlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  XP_010534777.1 31 KPRLRWTAELHERFVDAVSQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRL 85
                    79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.7552888IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.3E-322886IPR009057Homeodomain-like
SuperFamilySSF466893.05E-173086IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-243186IPR006447Myb domain, plants
PfamPF002491.4E-83383IPR001005SANT/Myb domain
PfamPF143799.3E-20128167IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MLGMAKKGMM NESRGMCVQG DSGLVLTTDP KPRLRWTAEL HERFVDAVSQ LGGPDKATPK  60
TIMRVMGVKG LTLYHLKSHL QKFRLGKQPH KDHNHDHSIK DTNRASTLDL QRNYVFSPGI  120
MGHNMNEMQM DVQRRIHEQI EVQRHLHLRM EAQGKYMQSM LEKACQTQAT LKGNNQPVLM  180
DHIVGFPSFN QRQEHDAPTS YGNKSSVLWF DDRFRLQEPS SSQTIDPLKD LPLQFGPPSV  240
DRDLNSTLDL YEMKLNYSED APSVISTSSA ACLE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010534777.10.0PREDICTED: myb family transcription factor APL-like
SwissprotQ9SAK51e-90APL_ARATH; Myb family transcription factor APL
TrEMBLA5ASR19e-93A5ASR1_VITVI; Putative uncharacterized protein
STRINGVIT_19s0085g00890.t013e-92(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM137451726
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79430.29e-92G2-like family protein