PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010534379.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family M-type_MADS
Protein Properties Length: 409aa    MW: 44818.9 Da    PI: 9.8332
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010534379.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF42.67.9e-141555343
                    --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
          SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                    i n+  r+ ++ kR+ g+ KK +EL +LCd+++++iifs++
  XP_010534379.1 15 IMNENARKSSLKKRKLGLVKKVQELTILCDVRACLIIFSNE 55
                    789999*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.0E-18564IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.652554IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.54E-22697IPR002100Transcription factor, MADS-box
CDDcd002664.53E-27689No hitNo description
PRINTSPR004046.1E-7727IPR002100Transcription factor, MADS-box
PfamPF003191.0E-131554IPR002100Transcription factor, MADS-box
PRINTSPR004046.1E-72742IPR002100Transcription factor, MADS-box
PRINTSPR004046.1E-74263IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 409 aa     Download sequence    Send to blast
MRATTGKRKV KLAWIMNENA RKSSLKKRKL GLVKKVQELT ILCDVRACLI IFSNEEANPL  60
VWPSQELARG LLDRYFSLPD IERSKKATNQ ESYLRDKAGK VQEQLVKSQK KNQEAEMDRL  120
MLQIINHSRT LSDLTMSEIY GLISYTKDKI NLLRKRGELI HQPPLHNVSS LPNQPLRDEP  180
AVAAPGGGGN GVGSNPMNHQ NQYLMDQWIF TPSISTNVGI PYQENQSYIH MGDTSIHRYG  240
SFLPDQGSGS NRANPNVEMN LMSPQNSQEG LALQSSYQST MMKLNLNNIN PSSGSSLVPM  300
GLGLPSLEGH ANPKAILRSQ LGPFPSNLTR HNLNLTAPLG GEGTNSKTPI ELGLQPFGTD  360
LLLQPLGHGG EYNSAGGGPR LQPPGEGSPS APRQGDMVGR YGANKDPSQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1628KRKVKLAWIMNENARKSSLKKRK
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010534379.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010534379.10.0PREDICTED: MADS-box transcription factor PHERES 2
STRINGXP_010534379.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM47241446
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40210.16e-38AGAMOUS-like 48