PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010533895.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 357aa    MW: 40105.3 Da    PI: 7.3318
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010533895.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.82.2e-53151421128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeelvv+yLkkkv++ +l++ ++i+evd+yk++Pw+Lp k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk++l++
  XP_010533895.1  15 LPPGFRFHPTDEELVVHYLKKKVASIPLPV-SIIAEVDLYKFDPWELPCKATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPILTS 108
                     79****************************.89***************8888899*************************************998 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++++vg+kk Lvfy g+ pkg kt+W+mheyrl
  XP_010533895.1 109 nSHHKVGVKKALVFYGGKPPKGIKTNWIMHEYRL 142
                     66778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.45E-6411175IPR003441NAC domain
PROSITE profilePS5100561.18715175IPR003441NAC domain
PfamPF023653.1E-2816142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MESANSCTKS SHPSLPPGFR FHPTDEELVV HYLKKKVASI PLPVSIIAEV DLYKFDPWEL  60
PCKATFGEQE WYFFSPRDRK YPNGARPNRA ATSGYWKATG TDKPILTSNS HHKVGVKKAL  120
VFYGGKPPKG IKTNWIMHEY RLIDGDVPNS KPDLSSSKKS SLRLDDWVLC RIYKKNTSHR  180
PMDQRAGEDL MDGMIATVQN LHHQNQKSSA NSSSSVLDNN EEQHFFMDCS TMVVSSSSNG  240
SDHLPLIKRN NPTLSNNDHQ YWISDTNSGS FGSSSLQNKR FHGDLNNGVD NNNNSIEEED  300
NDNNNSNNNN SFVSLLREIP QNSGFHGNGV IDSSLADHHH HGVLRQAFQL PNINWTS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-751417816168NO APICAL MERISTEM PROTEIN
1ut4_B3e-751417816168NO APICAL MERISTEM PROTEIN
1ut7_A3e-751417816168NO APICAL MERISTEM PROTEIN
1ut7_B3e-751417816168NO APICAL MERISTEM PROTEIN
4dul_A3e-751417816168NAC domain-containing protein 19
4dul_B3e-751417816168NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family. May be associated with anther development and pollen production (Probable). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305|PubMed:21107887}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00058PBMTransfer from AT1G61110Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010533895.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010533895.10.0PREDICTED: NAC transcription factor 25 isoform X1
SwissprotQ8GY421e-130NAC25_ARATH; NAC transcription factor 25
TrEMBLA0A2K2API51e-135A0A2K2API5_POPTR; Uncharacterized protein
STRINGXP_010533895.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19028276
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.11e-97NAC domain containing protein 25